Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 86771..86985 | Replicon | plasmid p1 |
Accession | NZ_CP091902 | ||
Organism | Enterococcus faecalis strain 59 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | L5I17_RS15485 | Protein ID | WP_002360667.1 |
Coordinates | 86771..86881 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 86921..86985 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L5I17_RS15445 | 81856..82227 | + | 372 | WP_238464148.1 | transposase | - |
L5I17_RS15450 | 82255..82596 | - | 342 | WP_238464150.1 | hypothetical protein | - |
L5I17_RS15455 | 82614..82814 | - | 201 | WP_238464151.1 | hypothetical protein | - |
L5I17_RS15460 | 83341..84078 | - | 738 | WP_128888465.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
L5I17_RS15465 | 84203..84286 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
L5I17_RS15470 | 84845..86173 | + | 1329 | WP_002370254.1 | ultraviolet resistance protein UvrA | - |
L5I17_RS15475 | 86170..86520 | + | 351 | WP_002360672.1 | hypothetical protein | - |
L5I17_RS15480 | 86477..86689 | + | 213 | WP_002360669.1 | hypothetical protein | - |
L5I17_RS15485 | 86771..86881 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 86921..86985 | - | 65 | - | - | Antitoxin |
L5I17_RS15490 | 87121..87417 | + | 297 | WP_002369784.1 | hypothetical protein | - |
L5I17_RS15495 | 87537..87812 | - | 276 | WP_002369783.1 | DNA segregation protein PrgO | - |
L5I17_RS15500 | 87790..88719 | - | 930 | WP_002366009.1 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') / erm(B) | - | 1..88965 | 88965 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T235181 WP_002360667.1 NZ_CP091902:86771-86881 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T235181 NZ_LR134226:2609371-2609478 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 65 bp
>AT235181 NZ_CP091902:c86985-86921 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|