Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 323620..323814 | Replicon | chromosome |
Accession | NZ_CP091899 | ||
Organism | Enterococcus faecalis strain 101-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | L5I21_RS01640 | Protein ID | WP_015543884.1 |
Coordinates | 323719..323814 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 323620..323684 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L5I21_RS01625 | 319253..320995 | + | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
L5I21_RS01630 | 320986..323019 | + | 2034 | WP_002387671.1 | PRD domain-containing protein | - |
L5I21_RS01635 | 323030..323464 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 323620..323684 | + | 65 | - | - | Antitoxin |
L5I21_RS01640 | 323719..323814 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
L5I21_RS01645 | 324060..325832 | + | 1773 | WP_010706745.1 | PTS mannitol-specific transporter subunit IIBC | - |
L5I21_RS01650 | 325847..326284 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
L5I21_RS01655 | 326299..327453 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
L5I21_RS01660 | 327520..328635 | - | 1116 | WP_002379062.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T235123 WP_015543884.1 NZ_CP091899:c323814-323719 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T235123 NZ_LR134216:2615694-2615801 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 65 bp
>AT235123 NZ_CP091899:323620-323684 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|