Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 332841..333036 | Replicon | chromosome |
Accession | NZ_CP091884 | ||
Organism | Enterococcus faecalis strain 152 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | L5I24_RS01715 | Protein ID | WP_015543884.1 |
Coordinates | 332941..333036 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 332841..332906 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L5I24_RS01700 | 328472..330214 | + | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
L5I24_RS01705 | 330205..332238 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
L5I24_RS01710 | 332249..332683 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 332841..332906 | + | 66 | - | - | Antitoxin |
L5I24_RS01715 | 332941..333036 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
L5I24_RS01720 | 333282..335054 | + | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
L5I24_RS01725 | 335069..335506 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
L5I24_RS01730 | 335521..336675 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
L5I24_RS01735 | 336744..337859 | - | 1116 | WP_002377910.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T234980 WP_015543884.1 NZ_CP091884:c333036-332941 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T234980 NZ_CP091884:c333036-332941 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT234980 NZ_CP091884:332841-332906 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|