Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 34504..34758 Replicon plasmid pB349aT_1
Accession NZ_CP091774
Organism Escherichia coli strain SWYH.B349aT

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag L6V99_RS23670 Protein ID WP_001312851.1
Coordinates 34504..34653 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 34697..34758 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L6V99_RS23625 (30067) 30067..30468 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
L6V99_RS23630 (30401) 30401..30658 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
L6V99_RS23635 (30751) 30751..31008 - 258 WP_230133887.1 CPBP family intramembrane metalloprotease -
L6V99_RS23640 (31001) 31001..31393 - 393 WP_000616804.1 histidine phosphatase family protein -
L6V99_RS23645 (32332) 32332..33189 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
L6V99_RS23650 (33182) 33182..33664 - 483 WP_001273588.1 hypothetical protein -
L6V99_RS23655 (33657) 33657..33704 - 48 WP_229471593.1 hypothetical protein -
L6V99_RS23660 (33695) 33695..33946 + 252 WP_223195197.1 replication protein RepA -
L6V99_RS23665 (33963) 33963..34220 - 258 WP_000083845.1 replication regulatory protein RepA -
L6V99_RS23670 (34504) 34504..34653 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (34697) 34697..34758 + 62 NuclAT_1 - Antitoxin
- (34697) 34697..34758 + 62 NuclAT_1 - Antitoxin
- (34697) 34697..34758 + 62 NuclAT_1 - Antitoxin
- (34697) 34697..34758 + 62 NuclAT_1 - Antitoxin
L6V99_RS23675 (35014) 35014..35088 - 75 Protein_44 endonuclease -
L6V99_RS23680 (35334) 35334..35546 - 213 WP_001299730.1 ANR family transcriptional regulator -
L6V99_RS23685 (35682) 35682..36242 - 561 WP_000139315.1 fertility inhibition protein FinO -
L6V99_RS23690 (36345) 36345..37205 - 861 WP_000704514.1 alpha/beta hydrolase -
L6V99_RS23695 (37264) 37264..38010 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / tet(B) / catA1 / sitABCD iutA / iucD / iucC / iucB / iucA 1..109860 109860


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T234757 WP_001312851.1 NZ_CP091774:c34653-34504 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T234757 NZ_LR134080:2832064-2832171 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT234757 NZ_CP091774:34697-34758 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References