Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34504..34758 | Replicon | plasmid pB349aT_1 |
| Accession | NZ_CP091774 | ||
| Organism | Escherichia coli strain SWYH.B349aT | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | L6V99_RS23670 | Protein ID | WP_001312851.1 |
| Coordinates | 34504..34653 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 34697..34758 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L6V99_RS23625 (30067) | 30067..30468 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| L6V99_RS23630 (30401) | 30401..30658 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| L6V99_RS23635 (30751) | 30751..31008 | - | 258 | WP_230133887.1 | CPBP family intramembrane metalloprotease | - |
| L6V99_RS23640 (31001) | 31001..31393 | - | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| L6V99_RS23645 (32332) | 32332..33189 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| L6V99_RS23650 (33182) | 33182..33664 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| L6V99_RS23655 (33657) | 33657..33704 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| L6V99_RS23660 (33695) | 33695..33946 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| L6V99_RS23665 (33963) | 33963..34220 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| L6V99_RS23670 (34504) | 34504..34653 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (34697) | 34697..34758 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (34697) | 34697..34758 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (34697) | 34697..34758 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (34697) | 34697..34758 | + | 62 | NuclAT_1 | - | Antitoxin |
| L6V99_RS23675 (35014) | 35014..35088 | - | 75 | Protein_44 | endonuclease | - |
| L6V99_RS23680 (35334) | 35334..35546 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| L6V99_RS23685 (35682) | 35682..36242 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| L6V99_RS23690 (36345) | 36345..37205 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| L6V99_RS23695 (37264) | 37264..38010 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / tet(B) / catA1 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..109860 | 109860 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T234757 WP_001312851.1 NZ_CP091774:c34653-34504 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T234757 NZ_LR134080:2832064-2832171 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT234757 NZ_CP091774:34697-34758 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|