Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-orzP/Ldr(toxin) |
Location | 1998404..1998625 | Replicon | chromosome |
Accession | NZ_CP091700 | ||
Organism | Escherichia coli strain KFu019 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | L6L55_RS10585 | Protein ID | WP_000170955.1 |
Coordinates | 1998404..1998511 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | orzP | ||
Locus tag | - | ||
Coordinates | 1998559..1998625 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L6L55_RS10560 (1994248) | 1994248..1995330 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
L6L55_RS10565 (1995330) | 1995330..1996163 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
L6L55_RS10570 (1996160) | 1996160..1996552 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
L6L55_RS10575 (1996556) | 1996556..1997365 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
L6L55_RS10580 (1997401) | 1997401..1998255 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
L6L55_RS10585 (1998404) | 1998404..1998511 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_39 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_39 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_39 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_39 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_42 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_42 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_42 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_42 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_45 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_45 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_45 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_45 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_48 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_48 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_48 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_48 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_55 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_55 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_55 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_55 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_58 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_58 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_58 | - | - |
- (1998561) | 1998561..1998624 | + | 64 | NuclAT_58 | - | - |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_15 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_15 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_15 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_15 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_21 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_21 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_21 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_21 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_30 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_30 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_30 | - | Antitoxin |
- (1998559) | 1998559..1998625 | + | 67 | NuclAT_30 | - | Antitoxin |
L6L55_RS10590 (1998939) | 1998939..1999046 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_37 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_37 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_37 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_37 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_40 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_40 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_40 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_40 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_43 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_43 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_43 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_43 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_46 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_46 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_46 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_46 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_53 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_53 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_53 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_53 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_56 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_56 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_56 | - | - |
- (1999094) | 1999094..1999159 | + | 66 | NuclAT_56 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_16 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_16 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_16 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_16 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_19 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_19 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_19 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_19 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_22 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_22 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_22 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_22 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_25 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_25 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_25 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_25 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_28 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_28 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_28 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_28 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_31 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_31 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_31 | - | - |
- (1999095) | 1999095..1999160 | + | 66 | NuclAT_31 | - | - |
L6L55_RS10595 (1999474) | 1999474..1999581 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_38 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_38 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_38 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_38 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_41 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_41 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_41 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_41 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_44 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_44 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_44 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_44 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_47 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_47 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_47 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_47 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_54 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_54 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_54 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_54 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_57 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_57 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_57 | - | - |
- (1999629) | 1999629..1999694 | + | 66 | NuclAT_57 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_17 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_17 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_17 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_17 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_20 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_20 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_20 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_20 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_23 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_23 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_23 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_23 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_26 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_26 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_26 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_26 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_29 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_29 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_29 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_29 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_32 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_32 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_32 | - | - |
- (1999630) | 1999630..1999695 | + | 66 | NuclAT_32 | - | - |
L6L55_RS10600 (1999985) | 1999985..2001085 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
L6L55_RS10605 (2001355) | 2001355..2001585 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
L6L55_RS10610 (2001743) | 2001743..2002438 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
L6L55_RS10615 (2002482) | 2002482..2002835 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T234568 WP_000170955.1 NZ_CP091700:c1998511-1998404 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T234568 NZ_LR130562:c842584-842210 [Escherichia coli]
ATGAAAACATTACCTGACACACACGTACGGGAGGCATCGCGTTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTCGC
CCGACTGCTGGACCAGCACTACGGCCTCACGCTGAATGACACTCCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCCGGCATTTCACTGTGCGATGCAGTGAACTTTCTTGTTGAAAAATACGAACTGGTGCGTACCGACCAGCCGGAATTC
AGTGCCTGTACCCGTTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGTATCCGGAGGCGAAATGA
ATGAAAACATTACCTGACACACACGTACGGGAGGCATCGCGTTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTCGC
CCGACTGCTGGACCAGCACTACGGCCTCACGCTGAATGACACTCCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCCGGCATTTCACTGTGCGATGCAGTGAACTTTCTTGTTGAAAAATACGAACTGGTGCGTACCGACCAGCCGGAATTC
AGTGCCTGTACCCGTTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGTATCCGGAGGCGAAATGA
Antitoxin
Download Length: 67 bp
>AT234568 NZ_CP091700:1998559-1998625 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|