Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4397368..4397590 | Replicon | chromosome |
Accession | NZ_CP091673 | ||
Organism | Escherichia coli strain KKo009 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A829L523 |
Locus tag | L6L68_RS22385 | Protein ID | WP_000170738.1 |
Coordinates | 4397368..4397475 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4397524..4397590 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L6L68_RS22355 | 4392397..4393968 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
L6L68_RS22360 | 4393965..4394156 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
L6L68_RS22365 | 4394153..4395832 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
L6L68_RS22370 | 4395919..4396026 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
L6L68_RS22375 | 4396402..4396509 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
L6L68_RS22380 | 4396885..4396992 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
L6L68_RS22385 | 4397368..4397475 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4397524..4397590 | + | 67 | - | - | Antitoxin |
L6L68_RS22390 | 4397951..4399222 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
L6L68_RS22395 | 4399252..4400256 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
L6L68_RS22400 | 4400253..4401236 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
L6L68_RS22405 | 4401247..4402149 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T234450 WP_000170738.1 NZ_CP091673:c4397475-4397368 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T234450 NZ_LR130543:4073983-4074201 [Klebsiella variicola]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAACTGGCGGTATTTTACTCAGCCGCCGATCATCGTCTGGCTGAAC
TGACCATGAATAAGCTGTACGATAAGATCCCGACCTCAGTCTGGAAGTTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAACTGGCGGTATTTTACTCAGCCGCCGATCATCGTCTGGCTGAAC
TGACCATGAATAAGCTGTACGATAAGATCCCGACCTCAGTCTGGAAGTTTATCCGCTAA
Antitoxin
Download Length: 67 bp
>AT234450 NZ_CP091673:4397524-4397590 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|