Detailed information of TA system TA234420

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 122460..122729
• Replicon: plasmid pKKo009_1
• Accession: NZ_CP091672
• Organism: Escherichia coli strain KKo009

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: L6L68_RS00595
• Protein ID: WP_001372321.1
• Coordinates: 122604..122729 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	122460..122525 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
L6L68_RS00560	117533..117781	+	249	WP_002433376.1	hypothetical protein	-
L6L68_RS00565	118254..118781	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
L6L68_RS00570	118837..119070	+	234	WP_000006004.1	DUF905 domain-containing protein	-
L6L68_RS00575	119129..121087	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
L6L68_RS00580	121142..121576	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
L6L68_RS00585	121573..122334	+	762	Protein_120	plasmid SOS inhibition protein A	-
-	122303..122527	+	225	NuclAT_0	-	-
-	122303..122527	+	225	NuclAT_0	-	-
-	122303..122527	+	225	NuclAT_0	-	-
-	122303..122527	+	225	NuclAT_0	-	-
-	122460..122525	-	66	-	-	Antitoxin
L6L68_RS00590	122513..122662	+	150	Protein_121	plasmid maintenance protein Mok	-
L6L68_RS00595	122604..122729	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
L6L68_RS00600	122949..123179	+	231	WP_001426396.1	hypothetical protein	-
L6L68_RS00605	123177..123350	-	174	Protein_124	hypothetical protein	-
L6L68_RS00610	123505..123792	+	288	WP_000107535.1	hypothetical protein	-
L6L68_RS00615	123915..124736	+	822	WP_001234469.1	DUF932 domain-containing protein	-
L6L68_RS00620	125033..125635	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
L6L68_RS00625	125956..126339	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
L6L68_RS00630	126526..127215	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
L6L68_RS00635	127308..127709	+	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / erm(B) / aac(3)-IId / blaTEM-1A / floR / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A)	espC / iroN / iroE / iroD / iroC / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..224424	224424

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T234420 WP_001372321.1 NZ_CP091672:122604-122729 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T234420 NZ_LR130539:1903838-1903940 [Klebsiella variicola]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 66 bp

>AT234420 NZ_CP091672:c122525-122460 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin