Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60684..60938 | Replicon | plasmid pKOr019_1 |
| Accession | NZ_CP091666 | ||
| Organism | Escherichia coli strain KOr019 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | L6L58_RS25225 | Protein ID | WP_001312851.1 |
| Coordinates | 60684..60833 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60877..60938 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L6L58_RS25190 (55937) | 55937..57052 | + | 1116 | Protein_51 | IS91 family transposase | - |
| L6L58_RS25195 (57233) | 57233..57577 | - | 345 | WP_001553768.1 | hypothetical protein | - |
| L6L58_RS25200 (58512) | 58512..59369 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| L6L58_RS25205 (59362) | 59362..59844 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| L6L58_RS25210 (59837) | 59837..59884 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| L6L58_RS25215 (59875) | 59875..60126 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| L6L58_RS25220 (60143) | 60143..60400 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| L6L58_RS25225 (60684) | 60684..60833 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (60877) | 60877..60938 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (60877) | 60877..60938 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (60877) | 60877..60938 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (60877) | 60877..60938 | + | 62 | NuclAT_1 | - | Antitoxin |
| L6L58_RS25230 (61194) | 61194..61268 | - | 75 | Protein_59 | endonuclease | - |
| L6L58_RS25235 (61514) | 61514..61726 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| L6L58_RS25240 (62065) | 62065..63642 | - | 1578 | WP_001323889.1 | PAS domain-containing methyl-accepting chemotaxis protein | - |
| L6L58_RS25245 (63952) | 63952..64512 | + | 561 | WP_001161490.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..158848 | 158848 | |
| - | flank | IS/Tn | - | - | 65762..67393 | 1631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T234410 WP_001312851.1 NZ_CP091666:c60833-60684 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T234410 NZ_LR130538:1878207-1878309 [Klebsiella variicola]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 62 bp
>AT234410 NZ_CP091666:60877-60938 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|