Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 60684..60938 Replicon plasmid pKOr019_1
Accession NZ_CP091666
Organism Escherichia coli strain KOr019

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag L6L58_RS25225 Protein ID WP_001312851.1
Coordinates 60684..60833 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 60877..60938 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L6L58_RS25190 (55937) 55937..57052 + 1116 Protein_51 IS91 family transposase -
L6L58_RS25195 (57233) 57233..57577 - 345 WP_001553768.1 hypothetical protein -
L6L58_RS25200 (58512) 58512..59369 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
L6L58_RS25205 (59362) 59362..59844 - 483 WP_001273588.1 hypothetical protein -
L6L58_RS25210 (59837) 59837..59884 - 48 WP_229471593.1 hypothetical protein -
L6L58_RS25215 (59875) 59875..60126 + 252 WP_223195197.1 replication protein RepA -
L6L58_RS25220 (60143) 60143..60400 - 258 WP_000083845.1 replication regulatory protein RepA -
L6L58_RS25225 (60684) 60684..60833 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (60877) 60877..60938 + 62 NuclAT_1 - Antitoxin
- (60877) 60877..60938 + 62 NuclAT_1 - Antitoxin
- (60877) 60877..60938 + 62 NuclAT_1 - Antitoxin
- (60877) 60877..60938 + 62 NuclAT_1 - Antitoxin
L6L58_RS25230 (61194) 61194..61268 - 75 Protein_59 endonuclease -
L6L58_RS25235 (61514) 61514..61726 - 213 WP_001299730.1 ANR family transcriptional regulator -
L6L58_RS25240 (62065) 62065..63642 - 1578 WP_001323889.1 PAS domain-containing methyl-accepting chemotaxis protein -
L6L58_RS25245 (63952) 63952..64512 + 561 WP_001161490.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..158848 158848
- flank IS/Tn - - 65762..67393 1631


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T234410 WP_001312851.1 NZ_CP091666:c60833-60684 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T234410 NZ_LR130538:1878207-1878309 [Klebsiella variicola]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 62 bp

>AT234410 NZ_CP091666:60877-60938 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References