Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2351379..2351600 Replicon chromosome
Accession NZ_CP091665
Organism Escherichia coli strain KOr019

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag L6L58_RS11185 Protein ID WP_000170954.1
Coordinates 2351379..2351486 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2351534..2351600 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L6L58_RS11160 (2347223) 2347223..2348305 + 1083 WP_000804726.1 peptide chain release factor 1 -
L6L58_RS11165 (2348305) 2348305..2349138 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
L6L58_RS11170 (2349135) 2349135..2349527 + 393 WP_000200374.1 invasion regulator SirB2 -
L6L58_RS11175 (2349531) 2349531..2350340 + 810 WP_001257044.1 invasion regulator SirB1 -
L6L58_RS11180 (2350376) 2350376..2351230 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
L6L58_RS11185 (2351379) 2351379..2351486 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2351536) 2351536..2351599 + 64 NuclAT_50 - -
- (2351536) 2351536..2351599 + 64 NuclAT_50 - -
- (2351536) 2351536..2351599 + 64 NuclAT_50 - -
- (2351536) 2351536..2351599 + 64 NuclAT_50 - -
- (2351536) 2351536..2351599 + 64 NuclAT_52 - -
- (2351536) 2351536..2351599 + 64 NuclAT_52 - -
- (2351536) 2351536..2351599 + 64 NuclAT_52 - -
- (2351536) 2351536..2351599 + 64 NuclAT_52 - -
- (2351536) 2351536..2351599 + 64 NuclAT_54 - -
- (2351536) 2351536..2351599 + 64 NuclAT_54 - -
- (2351536) 2351536..2351599 + 64 NuclAT_54 - -
- (2351536) 2351536..2351599 + 64 NuclAT_54 - -
- (2351536) 2351536..2351599 + 64 NuclAT_56 - -
- (2351536) 2351536..2351599 + 64 NuclAT_56 - -
- (2351536) 2351536..2351599 + 64 NuclAT_56 - -
- (2351536) 2351536..2351599 + 64 NuclAT_56 - -
- (2351534) 2351534..2351600 + 67 NuclAT_37 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_37 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_37 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_37 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_39 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_39 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_39 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_39 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_41 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_41 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_41 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_41 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_43 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_43 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_43 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_43 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_45 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_45 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_45 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_45 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_47 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_47 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_47 - Antitoxin
- (2351534) 2351534..2351600 + 67 NuclAT_47 - Antitoxin
L6L58_RS11190 (2351914) 2351914..2352021 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2352074) 2352074..2352135 + 62 NuclAT_49 - -
- (2352074) 2352074..2352135 + 62 NuclAT_49 - -
- (2352074) 2352074..2352135 + 62 NuclAT_49 - -
- (2352074) 2352074..2352135 + 62 NuclAT_49 - -
- (2352074) 2352074..2352135 + 62 NuclAT_51 - -
- (2352074) 2352074..2352135 + 62 NuclAT_51 - -
- (2352074) 2352074..2352135 + 62 NuclAT_51 - -
- (2352074) 2352074..2352135 + 62 NuclAT_51 - -
- (2352074) 2352074..2352135 + 62 NuclAT_53 - -
- (2352074) 2352074..2352135 + 62 NuclAT_53 - -
- (2352074) 2352074..2352135 + 62 NuclAT_53 - -
- (2352074) 2352074..2352135 + 62 NuclAT_53 - -
- (2352074) 2352074..2352135 + 62 NuclAT_55 - -
- (2352074) 2352074..2352135 + 62 NuclAT_55 - -
- (2352074) 2352074..2352135 + 62 NuclAT_55 - -
- (2352074) 2352074..2352135 + 62 NuclAT_55 - -
- (2352074) 2352074..2352136 + 63 NuclAT_38 - -
- (2352074) 2352074..2352136 + 63 NuclAT_38 - -
- (2352074) 2352074..2352136 + 63 NuclAT_38 - -
- (2352074) 2352074..2352136 + 63 NuclAT_38 - -
- (2352074) 2352074..2352136 + 63 NuclAT_40 - -
- (2352074) 2352074..2352136 + 63 NuclAT_40 - -
- (2352074) 2352074..2352136 + 63 NuclAT_40 - -
- (2352074) 2352074..2352136 + 63 NuclAT_40 - -
- (2352074) 2352074..2352136 + 63 NuclAT_42 - -
- (2352074) 2352074..2352136 + 63 NuclAT_42 - -
- (2352074) 2352074..2352136 + 63 NuclAT_42 - -
- (2352074) 2352074..2352136 + 63 NuclAT_42 - -
- (2352074) 2352074..2352136 + 63 NuclAT_44 - -
- (2352074) 2352074..2352136 + 63 NuclAT_44 - -
- (2352074) 2352074..2352136 + 63 NuclAT_44 - -
- (2352074) 2352074..2352136 + 63 NuclAT_44 - -
- (2352074) 2352074..2352136 + 63 NuclAT_46 - -
- (2352074) 2352074..2352136 + 63 NuclAT_46 - -
- (2352074) 2352074..2352136 + 63 NuclAT_46 - -
- (2352074) 2352074..2352136 + 63 NuclAT_46 - -
- (2352074) 2352074..2352136 + 63 NuclAT_48 - -
- (2352074) 2352074..2352136 + 63 NuclAT_48 - -
- (2352074) 2352074..2352136 + 63 NuclAT_48 - -
- (2352074) 2352074..2352136 + 63 NuclAT_48 - -
L6L58_RS11195 (2352427) 2352427..2353527 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
L6L58_RS11200 (2353797) 2353797..2354027 + 231 WP_001146442.1 putative cation transport regulator ChaB -
L6L58_RS11205 (2354185) 2354185..2354880 + 696 WP_101174716.1 glutathione-specific gamma-glutamylcyclotransferase -
L6L58_RS11210 (2354924) 2354924..2355277 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T234389 WP_000170954.1 NZ_CP091665:c2351486-2351379 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T234389 NZ_LR130534:c5859539-5859261 [Pseudomonas aeruginosa]
ATGATTCTGACCTTTCGCTGCGACGAGACTCGTCAGCTTTTTGAGACGGGTCTTTCGAGGCGGTGGGGAGCGATCCTCAC
AGTCGCTACGCGTAAGCTCGCAATGCTTCATGCGGCTACGGAGCTTCGAGACTTGCGCTCTCCACCTGGAAACCGGTTGG
AGCCGTTGCAGGGAAAGCGGGCGGGCCAACATAGCATCAGGATCAATGACCAGTGGCGTGTCTGTTTCGTCTGGACGGAT
GCGGGTCCCGAAGAAGTCGAAATAGTTGATTACCACTGA

Antitoxin


Download         Length: 67 bp

>AT234389 NZ_CP091665:2351534-2351600 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References