Detailed information of TA system TA234297

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 103078..103311
• Replicon: plasmid pKFu024_1
• Accession: NZ_CP091658
• Organism: Escherichia coli strain KFu024

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: L6L61_RS00655
• Protein ID: WP_001372321.1
• Coordinates: 103078..103203 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	103280..103311 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
L6L61_RS00615 (98452)	98452..99141	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
L6L61_RS00620 (99328)	99328..99711	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
L6L61_RS00625 (100032)	100032..100634	+	603	WP_169772891.1	transglycosylase SLT domain-containing protein	-
L6L61_RS00630 (100931)	100931..101752	-	822	WP_001234426.1	DUF932 domain-containing protein	-
L6L61_RS00635 (101870)	101870..102157	-	288	WP_000107535.1	hypothetical protein	-
L6L61_RS00640 (102182)	102182..102388	-	207	WP_000547968.1	hypothetical protein	-
L6L61_RS00645 (102458)	102458..102630	+	173	Protein_128	hypothetical protein	-
L6L61_RS00650 (102628)	102628..102858	-	231	WP_071886920.1	hypothetical protein	-
L6L61_RS00655 (103078)	103078..103203	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
L6L61_RS00660 (103145)	103145..103294	-	150	Protein_131	plasmid maintenance protein Mok	-
- (103280)	103280..103311	-	32	NuclAT_1	-	Antitoxin
- (103280)	103280..103311	-	32	NuclAT_1	-	Antitoxin
- (103280)	103280..103311	-	32	NuclAT_1	-	Antitoxin
- (103280)	103280..103311	-	32	NuclAT_1	-	Antitoxin
- (104753)	104753..104950	-	198	NuclAT_0	-	-
- (104753)	104753..104950	-	198	NuclAT_0	-	-
- (104753)	104753..104950	-	198	NuclAT_0	-	-
- (104753)	104753..104950	-	198	NuclAT_0	-	-
L6L61_RS00670 (104762)	104762..104950	+	189	WP_001299721.1	hypothetical protein	-
L6L61_RS00675 (104919)	104919..105681	-	763	Protein_134	plasmid SOS inhibition protein A	-
L6L61_RS00680 (105678)	105678..106112	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
L6L61_RS00685 (106167)	106167..106364	-	198	Protein_136	hypothetical protein	-
L6L61_RS00690 (106392)	106392..106625	-	234	WP_000005990.1	DUF905 family protein	-
L6L61_RS00695 (106693)	106693..107232	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
L6L61_RS00700 (107258)	107258..107464	-	207	WP_000275856.1	hypothetical protein	-
L6L61_RS00705 (107704)	107704..107955	-	252	WP_071579736.1	hypothetical protein	-
L6L61_RS00710 (107874)	107874..108080	-	207	WP_001774176.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / aac(3)-IId / erm(B) / mph(A) / sul1 / qacE / aadA5	iutA / iucD / iucC / iucB / iucA	1..137247	137247

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T234297 WP_001372321.1 NZ_CP091658:c103203-103078 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T234297 NZ_LR130513:c1516504-1516328 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA

Antitoxin

Nucleotide

• Length: 32 bp

>AT234297 NZ_CP091658:c103311-103280 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin