Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2528192..2528714 | Replicon | chromosome |
Accession | NZ_CP091544 | ||
Organism | Salmonella enterica strain 1618 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | L4414_RS12485 | Protein ID | WP_000221343.1 |
Coordinates | 2528430..2528714 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | L4414_RS12480 | Protein ID | WP_000885424.1 |
Coordinates | 2528192..2528440 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L4414_RS12455 (2523408) | 2523408..2524874 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
L4414_RS12460 (2525682) | 2525682..2526396 | + | 715 | Protein_2446 | helix-turn-helix domain-containing protein | - |
L4414_RS12465 (2526452) | 2526452..2527360 | - | 909 | WP_010989018.1 | hypothetical protein | - |
L4414_RS12470 (2527503) | 2527503..2527835 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
L4414_RS12475 (2527825) | 2527825..2528040 | - | 216 | WP_000206207.1 | hypothetical protein | - |
L4414_RS12480 (2528192) | 2528192..2528440 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
L4414_RS12485 (2528430) | 2528430..2528714 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
L4414_RS12490 (2528885) | 2528885..2529274 | + | 390 | WP_000194089.1 | RidA family protein | - |
L4414_RS12495 (2529326) | 2529326..2530405 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
L4414_RS12500 (2530598) | 2530598..2531086 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
L4414_RS12505 (2531131) | 2531131..2532639 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2523411..2535496 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T233637 WP_000221343.1 NZ_CP091544:2528430-2528714 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |