Detailed information of TA system TA233566

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 100633..101059
• Replicon: plasmid p537-20_1
• Accession: NZ_CP091535
• Organism: Escherichia coli strain 537-20

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: L6D13_RS24470
• Protein ID: WP_001372321.1
• Coordinates: 100633..100758 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	100835..101059 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
L6D13_RS24430 (96008)	96008..96696	-	689	Protein_98	conjugal transfer transcriptional regulator TraJ	-
L6D13_RS24435 (96883)	96883..97266	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
L6D13_RS24440 (97587)	97587..98189	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
L6D13_RS24445 (98486)	98486..99307	-	822	WP_001234426.1	DUF932 domain-containing protein	-
L6D13_RS24450 (99425)	99425..99712	-	288	WP_236932593.1	hypothetical protein	-
L6D13_RS24455 (99737)	99737..99943	-	207	WP_000547968.1	hypothetical protein	-
L6D13_RS24460 (100013)	100013..100185	+	173	Protein_104	hypothetical protein	-
L6D13_RS24465 (100183)	100183..100413	-	231	WP_071586998.1	hypothetical protein	-
L6D13_RS24470 (100633)	100633..100758	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
L6D13_RS24475 (100700)	100700..100849	-	150	Protein_107	plasmid maintenance protein Mok	-
- (100835)	100835..101059	-	225	NuclAT_0	-	Antitoxin
- (100835)	100835..101059	-	225	NuclAT_0	-	Antitoxin
- (100835)	100835..101059	-	225	NuclAT_0	-	Antitoxin
- (100835)	100835..101059	-	225	NuclAT_0	-	Antitoxin
L6D13_RS24480 (100871)	100871..101059	+	189	WP_001299721.1	hypothetical protein	-
L6D13_RS24485 (101028)	101028..101790	-	763	Protein_109	plasmid SOS inhibition protein A	-
L6D13_RS24490 (101787)	101787..102221	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
L6D13_RS24495 (102276)	102276..102473	-	198	Protein_111	hypothetical protein	-
L6D13_RS24500 (102501)	102501..102734	-	234	WP_000005990.1	DUF905 family protein	-
L6D13_RS24505 (102802)	102802..103341	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
L6D13_RS24510 (103367)	103367..103573	-	207	WP_000275856.1	hypothetical protein	-
L6D13_RS24515 (103643)	103643..103723	+	81	Protein_115	hypothetical protein	-
L6D13_RS24520 (103906)	103906..104075	-	170	Protein_116	hypothetical protein	-
L6D13_RS24525 (104669)	104669..105640	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA	1..126021	126021

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T233566 WP_001372321.1 NZ_CP091535:c100758-100633 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T233566 NZ_HG994850:188778-188885 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA

Antitoxin

Nucleotide

• Length: 225 bp

>AT233566 NZ_CP091535:c101059-100835 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin