Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1286504..1286725 Replicon chromosome
Accession NC_011742
Organism Escherichia coli S88

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag ECS88_RS07595 Protein ID WP_000170954.1
Coordinates 1286504..1286611 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1286664..1286725 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECS88_RS07570 1282349..1283431 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECS88_RS07575 1283431..1284264 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECS88_RS07580 1284261..1284653 + 393 WP_000200375.1 invasion regulator SirB2 -
ECS88_RS07585 1284657..1285466 + 810 WP_001257054.1 invasion regulator SirB1 -
ECS88_RS07590 1285502..1286356 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECS88_RS07595 1286504..1286611 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1286664..1286725 + 62 NuclAT_12 - Antitoxin
- 1286664..1286725 + 62 NuclAT_12 - Antitoxin
- 1286664..1286725 + 62 NuclAT_12 - Antitoxin
- 1286664..1286725 + 62 NuclAT_12 - Antitoxin
- 1286664..1286725 + 62 NuclAT_13 - Antitoxin
- 1286664..1286725 + 62 NuclAT_13 - Antitoxin
- 1286664..1286725 + 62 NuclAT_13 - Antitoxin
- 1286664..1286725 + 62 NuclAT_13 - Antitoxin
- 1286664..1286725 + 62 NuclAT_14 - Antitoxin
- 1286664..1286725 + 62 NuclAT_14 - Antitoxin
- 1286664..1286725 + 62 NuclAT_14 - Antitoxin
- 1286664..1286725 + 62 NuclAT_14 - Antitoxin
- 1286664..1286725 + 62 NuclAT_15 - Antitoxin
- 1286664..1286725 + 62 NuclAT_15 - Antitoxin
- 1286664..1286725 + 62 NuclAT_15 - Antitoxin
- 1286664..1286725 + 62 NuclAT_15 - Antitoxin
- 1286664..1286725 + 62 NuclAT_16 - Antitoxin
- 1286664..1286725 + 62 NuclAT_16 - Antitoxin
- 1286664..1286725 + 62 NuclAT_16 - Antitoxin
- 1286664..1286725 + 62 NuclAT_16 - Antitoxin
- 1286664..1286725 + 62 NuclAT_17 - Antitoxin
- 1286664..1286725 + 62 NuclAT_17 - Antitoxin
- 1286664..1286725 + 62 NuclAT_17 - Antitoxin
- 1286664..1286725 + 62 NuclAT_17 - Antitoxin
- 1286664..1286726 + 63 NuclAT_10 - -
- 1286664..1286726 + 63 NuclAT_10 - -
- 1286664..1286726 + 63 NuclAT_10 - -
- 1286664..1286726 + 63 NuclAT_10 - -
- 1286664..1286726 + 63 NuclAT_11 - -
- 1286664..1286726 + 63 NuclAT_11 - -
- 1286664..1286726 + 63 NuclAT_11 - -
- 1286664..1286726 + 63 NuclAT_11 - -
- 1286664..1286726 + 63 NuclAT_6 - -
- 1286664..1286726 + 63 NuclAT_6 - -
- 1286664..1286726 + 63 NuclAT_6 - -
- 1286664..1286726 + 63 NuclAT_6 - -
- 1286664..1286726 + 63 NuclAT_7 - -
- 1286664..1286726 + 63 NuclAT_7 - -
- 1286664..1286726 + 63 NuclAT_7 - -
- 1286664..1286726 + 63 NuclAT_7 - -
- 1286664..1286726 + 63 NuclAT_8 - -
- 1286664..1286726 + 63 NuclAT_8 - -
- 1286664..1286726 + 63 NuclAT_8 - -
- 1286664..1286726 + 63 NuclAT_8 - -
- 1286664..1286726 + 63 NuclAT_9 - -
- 1286664..1286726 + 63 NuclAT_9 - -
- 1286664..1286726 + 63 NuclAT_9 - -
- 1286664..1286726 + 63 NuclAT_9 - -
- 1286664..1286727 + 64 NuclAT_18 - -
- 1286664..1286727 + 64 NuclAT_18 - -
- 1286664..1286727 + 64 NuclAT_18 - -
- 1286664..1286727 + 64 NuclAT_18 - -
- 1286664..1286727 + 64 NuclAT_19 - -
- 1286664..1286727 + 64 NuclAT_19 - -
- 1286664..1286727 + 64 NuclAT_19 - -
- 1286664..1286727 + 64 NuclAT_19 - -
- 1286664..1286727 + 64 NuclAT_20 - -
- 1286664..1286727 + 64 NuclAT_20 - -
- 1286664..1286727 + 64 NuclAT_20 - -
- 1286664..1286727 + 64 NuclAT_20 - -
- 1286664..1286727 + 64 NuclAT_21 - -
- 1286664..1286727 + 64 NuclAT_21 - -
- 1286664..1286727 + 64 NuclAT_21 - -
- 1286664..1286727 + 64 NuclAT_21 - -
- 1286664..1286727 + 64 NuclAT_22 - -
- 1286664..1286727 + 64 NuclAT_22 - -
- 1286664..1286727 + 64 NuclAT_22 - -
- 1286664..1286727 + 64 NuclAT_22 - -
- 1286664..1286727 + 64 NuclAT_23 - -
- 1286664..1286727 + 64 NuclAT_23 - -
- 1286664..1286727 + 64 NuclAT_23 - -
- 1286664..1286727 + 64 NuclAT_23 - -
ECS88_RS07605 1287017..1288117 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
ECS88_RS07610 1288387..1288617 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECS88_RS07615 1288775..1289470 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
ECS88_RS07620 1289514..1289867 - 354 WP_001169658.1 DsrE/F sulfur relay family protein YchN -
ECS88_RS07625 1290052..1291446 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T23354 WP_000170954.1 NC_011742:c1286611-1286504 [Escherichia coli S88]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T23354 NC_011742:c1286611-1286504 [Escherichia coli S88]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT23354 NC_011742:1286664-1286725 [Escherichia coli S88]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References