Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 19731..20069 | Replicon | chromosome |
Accession | NZ_CP091412 | ||
Organism | Staphylococcus aureus strain ATR-20003 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | L3I92_RS00105 | Protein ID | WP_011447039.1 |
Coordinates | 19731..19907 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 19895..20069 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L3I92_RS00085 | 14966..18751 | + | 3786 | WP_237269210.1 | phage tail spike protein | - |
L3I92_RS00090 | 18741..18884 | + | 144 | WP_031783159.1 | hypothetical protein | - |
L3I92_RS00095 | 18940..19227 | + | 288 | WP_001040254.1 | hypothetical protein | - |
L3I92_RS00100 | 19285..19581 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
L3I92_RS00105 | 19731..19907 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 19895..20069 | - | 175 | - | - | Antitoxin |
L3I92_RS00115 | 20119..20373 | + | 255 | WP_000611512.1 | phage holin | - |
L3I92_RS00120 | 20385..21140 | + | 756 | WP_237269211.1 | CHAP domain-containing protein | - |
L3I92_RS00125 | 21633..22802 | - | 1170 | Protein_24 | AbgT family transporter | - |
L3I92_RS00130 | 23038..23856 | + | 819 | WP_000824951.1 | SDR family oxidoreductase | - |
L3I92_RS00135 | 23957..24724 | + | 768 | WP_049295992.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1..21140 | 21139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T233269 WP_011447039.1 NZ_CP091412:19731-19907 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT233269 NZ_CP091412:c20069-19895 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGACTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTGTTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGACTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTGTTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|