Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 3612429..3612648 Replicon chromosome
Accession NC_011740
Organism Escherichia fergusonii ATCC 35469

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag EFER_RS24275 Protein ID WP_001295224.1
Coordinates 3612429..3612536 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 3612585..3612648 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EFER_RS17675 3607472..3609031 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
EFER_RS17680 3609028..3609219 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
EFER_RS17685 3609216..3610895 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
EFER_RS23330 3610982..3611089 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3611147..3611201 + 55 NuclAT_19 - -
- 3611147..3611201 + 55 NuclAT_19 - -
- 3611147..3611201 + 55 NuclAT_19 - -
- 3611147..3611201 + 55 NuclAT_19 - -
- 3611147..3611201 + 55 NuclAT_21 - -
- 3611147..3611201 + 55 NuclAT_21 - -
- 3611147..3611201 + 55 NuclAT_21 - -
- 3611147..3611201 + 55 NuclAT_21 - -
- 3611147..3611201 + 55 NuclAT_23 - -
- 3611147..3611201 + 55 NuclAT_23 - -
- 3611147..3611201 + 55 NuclAT_23 - -
- 3611147..3611201 + 55 NuclAT_23 - -
- 3611147..3611201 + 55 NuclAT_25 - -
- 3611147..3611201 + 55 NuclAT_25 - -
- 3611147..3611201 + 55 NuclAT_25 - -
- 3611147..3611201 + 55 NuclAT_25 - -
- 3611147..3611203 + 57 NuclAT_12 - -
- 3611147..3611203 + 57 NuclAT_12 - -
- 3611147..3611203 + 57 NuclAT_12 - -
- 3611147..3611203 + 57 NuclAT_12 - -
- 3611147..3611203 + 57 NuclAT_14 - -
- 3611147..3611203 + 57 NuclAT_14 - -
- 3611147..3611203 + 57 NuclAT_14 - -
- 3611147..3611203 + 57 NuclAT_14 - -
EFER_RS24260 3611464..3611571 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
EFER_RS24270 3611946..3612053 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
EFER_RS24275 3612429..3612536 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3612585..3612648 + 64 NuclAT_18 - Antitoxin
- 3612585..3612648 + 64 NuclAT_18 - Antitoxin
- 3612585..3612648 + 64 NuclAT_18 - Antitoxin
- 3612585..3612648 + 64 NuclAT_18 - Antitoxin
- 3612585..3612648 + 64 NuclAT_20 - Antitoxin
- 3612585..3612648 + 64 NuclAT_20 - Antitoxin
- 3612585..3612648 + 64 NuclAT_20 - Antitoxin
- 3612585..3612648 + 64 NuclAT_20 - Antitoxin
- 3612585..3612648 + 64 NuclAT_22 - Antitoxin
- 3612585..3612648 + 64 NuclAT_22 - Antitoxin
- 3612585..3612648 + 64 NuclAT_22 - Antitoxin
- 3612585..3612648 + 64 NuclAT_22 - Antitoxin
- 3612585..3612648 + 64 NuclAT_24 - Antitoxin
- 3612585..3612648 + 64 NuclAT_24 - Antitoxin
- 3612585..3612648 + 64 NuclAT_24 - Antitoxin
- 3612585..3612648 + 64 NuclAT_24 - Antitoxin
- 3612585..3612650 + 66 NuclAT_11 - -
- 3612585..3612650 + 66 NuclAT_11 - -
- 3612585..3612650 + 66 NuclAT_11 - -
- 3612585..3612650 + 66 NuclAT_11 - -
- 3612585..3612650 + 66 NuclAT_13 - -
- 3612585..3612650 + 66 NuclAT_13 - -
- 3612585..3612650 + 66 NuclAT_13 - -
- 3612585..3612650 + 66 NuclAT_13 - -
EFER_RS17705 3612972..3614168 + 1197 WP_001016304.1 methionine gamma-lyase -
EFER_RS17710 3614418..3615716 + 1299 WP_001152710.1 amino acid permease -
EFER_RS17715 3615732..3616943 - 1212 WP_024256550.1 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T23321 WP_001295224.1 NC_011740:c3612536-3612429 [Escherichia fergusonii ATCC 35469]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T23321 NC_011740:c3612536-3612429 [Escherichia fergusonii ATCC 35469]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT23321 NC_011740:3612585-3612648 [Escherichia fergusonii ATCC 35469]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7


Antitoxin

Download structure file

References