Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 3610982..3611201 | Replicon | chromosome |
Accession | NC_011740 | ||
Organism | Escherichia fergusonii ATCC 35469 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | EFER_RS23330 | Protein ID | WP_001295224.1 |
Coordinates | 3610982..3611089 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 3611147..3611201 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFER_RS17665 | 3606218..3606985 | - | 768 | WP_000279501.1 | cellulose biosynthesis protein BcsQ | - |
EFER_RS17670 | 3606997..3607185 | - | 189 | WP_001063310.1 | YhjR family protein | - |
EFER_RS17675 | 3607472..3609031 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
EFER_RS17680 | 3609028..3609219 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
EFER_RS17685 | 3609216..3610895 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
EFER_RS23330 | 3610982..3611089 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3611147..3611201 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_21 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_21 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_21 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_21 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_23 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_23 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_23 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_23 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 3611147..3611201 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 3611147..3611203 | + | 57 | NuclAT_12 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_12 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_12 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_12 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_14 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_14 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_14 | - | - |
- | 3611147..3611203 | + | 57 | NuclAT_14 | - | - |
EFER_RS24260 | 3611464..3611571 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
EFER_RS24270 | 3611946..3612053 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
EFER_RS24275 | 3612429..3612536 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 3612585..3612648 | + | 64 | NuclAT_18 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_18 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_18 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_18 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_20 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_20 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_20 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_20 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_22 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_22 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_22 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_22 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_24 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_24 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_24 | - | - |
- | 3612585..3612648 | + | 64 | NuclAT_24 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_11 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_11 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_11 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_11 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_13 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_13 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_13 | - | - |
- | 3612585..3612650 | + | 66 | NuclAT_13 | - | - |
EFER_RS17705 | 3612972..3614168 | + | 1197 | WP_001016304.1 | methionine gamma-lyase | - |
EFER_RS17710 | 3614418..3615716 | + | 1299 | WP_001152710.1 | amino acid permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T23317 WP_001295224.1 NC_011740:c3611089-3610982 [Escherichia fergusonii ATCC 35469]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T23317 NC_011740:c3611089-3610982 [Escherichia fergusonii ATCC 35469]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 55 bp
>AT23317 NC_011740:3611147-3611201 [Escherichia fergusonii ATCC 35469]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|