Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 1672757..1672951 | Replicon | chromosome |
Accession | NZ_CP091198 | ||
Organism | Enterococcus faecalis strain UK045 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | L2629_RS08945 | Protein ID | WP_015543884.1 |
Coordinates | 1672856..1672951 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 1672757..1672821 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2629_RS08930 | 1668390..1670132 | + | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
L2629_RS08935 | 1670123..1672156 | + | 2034 | WP_002387671.1 | PRD domain-containing protein | - |
L2629_RS08940 | 1672167..1672601 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 1672757..1672821 | + | 65 | - | - | Antitoxin |
L2629_RS08945 | 1672856..1672951 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
L2629_RS08950 | 1673197..1674969 | + | 1773 | WP_010706745.1 | PTS mannitol-specific transporter subunit IIBC | - |
L2629_RS08955 | 1674984..1675421 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
L2629_RS08960 | 1675436..1676590 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
L2629_RS08965 | 1676657..1677772 | - | 1116 | WP_002379062.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T232907 WP_015543884.1 NZ_CP091198:c1672951-1672856 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T232907 NZ_CP128464:c2679013-2678870 [Enterococcus faecalis]
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAGACAATTCAGACGATCCTAGGTTTTGG
TATGTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAGACAATTCAGACGATCCTAGGTTTTGG
TATGTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
Antitoxin
Download Length: 65 bp
>AT232907 NZ_CP091198:1672757-1672821 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|