Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 1830894..1831201 | Replicon | chromosome |
Accession | NZ_CP091066 | ||
Organism | Staphylococcus aureus strain UMCG579 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | L1O91_RS08715 | Protein ID | WP_077446684.1 |
Coordinates | 1831025..1831201 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 1830894..1831033 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L1O91_RS08675 (1826463) | 1826463..1826642 | + | 180 | WP_000669789.1 | hypothetical protein | - |
L1O91_RS08680 (1826953) | 1826953..1827213 | + | 261 | WP_001791826.1 | hypothetical protein | - |
L1O91_RS08685 (1827266) | 1827266..1827616 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
L1O91_RS08690 (1828125) | 1828125..1828460 | - | 336 | Protein_1707 | SH3 domain-containing protein | - |
L1O91_RS08695 (1829110) | 1829110..1829601 | - | 492 | WP_000919350.1 | staphylokinase | - |
L1O91_RS08700 (1829792) | 1829792..1830547 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
L1O91_RS08705 (1830559) | 1830559..1830813 | - | 255 | WP_000611512.1 | phage holin | - |
L1O91_RS08710 (1830865) | 1830865..1830972 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- (1830894) | 1830894..1831033 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1830894) | 1830894..1831033 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1830894) | 1830894..1831033 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1830894) | 1830894..1831033 | + | 140 | NuclAT_0 | - | Antitoxin |
L1O91_RS08715 (1831025) | 1831025..1831201 | - | 177 | WP_077446684.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
L1O91_RS08720 (1831353) | 1831353..1831664 | - | 312 | WP_054190602.1 | DUF2951 family protein | - |
L1O91_RS08725 (1831722) | 1831722..1832009 | - | 288 | WP_001040261.1 | hypothetical protein | - |
L1O91_RS08730 (1832056) | 1832056..1832208 | - | 153 | WP_001153681.1 | hypothetical protein | - |
L1O91_RS08735 (1832198) | 1832198..1835983 | - | 3786 | Protein_1716 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / lukD / hlgA | 1827266..1891350 | 64084 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6844.44 Da Isoelectric Point: 9.9479
>T232649 WP_077446684.1 NZ_CP091066:c1831201-1831025 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKFIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKFIELSNKK
Download Length: 177 bp
>T232649 NZ_CP127851:60769-60918 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 140 bp
>AT232649 NZ_CP091066:1830894-1831033 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|