Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2817066..2817286 Replicon chromosome
Accession NZ_CP091022
Organism Escherichia coli strain STEC276

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag L1O93_RS13880 Protein ID WP_000170963.1
Coordinates 2817179..2817286 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2817066..2817132 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L1O93_RS13855 2813389..2813742 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
L1O93_RS13860 2813786..2814481 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
L1O93_RS13865 2814639..2814869 - 231 WP_001146444.1 putative cation transport regulator ChaB -
L1O93_RS13870 2815139..2816239 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2816529..2816596 - 68 NuclAT_38 - -
- 2816529..2816596 - 68 NuclAT_38 - -
- 2816529..2816596 - 68 NuclAT_38 - -
- 2816529..2816596 - 68 NuclAT_38 - -
- 2816529..2816596 - 68 NuclAT_41 - -
- 2816529..2816596 - 68 NuclAT_41 - -
- 2816529..2816596 - 68 NuclAT_41 - -
- 2816529..2816596 - 68 NuclAT_41 - -
- 2816529..2816596 - 68 NuclAT_44 - -
- 2816529..2816596 - 68 NuclAT_44 - -
- 2816529..2816596 - 68 NuclAT_44 - -
- 2816529..2816596 - 68 NuclAT_44 - -
- 2816529..2816596 - 68 NuclAT_47 - -
- 2816529..2816596 - 68 NuclAT_47 - -
- 2816529..2816596 - 68 NuclAT_47 - -
- 2816529..2816596 - 68 NuclAT_47 - -
- 2816531..2816596 - 66 NuclAT_18 - -
- 2816531..2816596 - 66 NuclAT_18 - -
- 2816531..2816596 - 66 NuclAT_18 - -
- 2816531..2816596 - 66 NuclAT_18 - -
- 2816531..2816596 - 66 NuclAT_21 - -
- 2816531..2816596 - 66 NuclAT_21 - -
- 2816531..2816596 - 66 NuclAT_21 - -
- 2816531..2816596 - 66 NuclAT_21 - -
- 2816531..2816596 - 66 NuclAT_24 - -
- 2816531..2816596 - 66 NuclAT_24 - -
- 2816531..2816596 - 66 NuclAT_24 - -
- 2816531..2816596 - 66 NuclAT_24 - -
- 2816531..2816596 - 66 NuclAT_27 - -
- 2816531..2816596 - 66 NuclAT_27 - -
- 2816531..2816596 - 66 NuclAT_27 - -
- 2816531..2816596 - 66 NuclAT_27 - -
- 2816531..2816596 - 66 NuclAT_31 - -
- 2816531..2816596 - 66 NuclAT_31 - -
- 2816531..2816596 - 66 NuclAT_31 - -
- 2816531..2816596 - 66 NuclAT_31 - -
- 2816531..2816596 - 66 NuclAT_34 - -
- 2816531..2816596 - 66 NuclAT_34 - -
- 2816531..2816596 - 66 NuclAT_34 - -
- 2816531..2816596 - 66 NuclAT_34 - -
L1O93_RS13875 2816644..2816751 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2817066..2817132 - 67 - - Antitoxin
L1O93_RS13880 2817179..2817286 + 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
L1O93_RS13885 2817595..2818964 + 1370 WP_085947770.1 IS3-like element IS150 family transposase -
- 2819046..2819111 - 66 NuclAT_39 - -
- 2819046..2819111 - 66 NuclAT_39 - -
- 2819046..2819111 - 66 NuclAT_39 - -
- 2819046..2819111 - 66 NuclAT_39 - -
- 2819046..2819111 - 66 NuclAT_42 - -
- 2819046..2819111 - 66 NuclAT_42 - -
- 2819046..2819111 - 66 NuclAT_42 - -
- 2819046..2819111 - 66 NuclAT_42 - -
- 2819046..2819111 - 66 NuclAT_45 - -
- 2819046..2819111 - 66 NuclAT_45 - -
- 2819046..2819111 - 66 NuclAT_45 - -
- 2819046..2819111 - 66 NuclAT_45 - -
- 2819046..2819111 - 66 NuclAT_48 - -
- 2819046..2819111 - 66 NuclAT_48 - -
- 2819046..2819111 - 66 NuclAT_48 - -
- 2819046..2819111 - 66 NuclAT_48 - -
- 2819048..2819111 - 64 NuclAT_17 - -
- 2819048..2819111 - 64 NuclAT_17 - -
- 2819048..2819111 - 64 NuclAT_17 - -
- 2819048..2819111 - 64 NuclAT_17 - -
- 2819048..2819111 - 64 NuclAT_20 - -
- 2819048..2819111 - 64 NuclAT_20 - -
- 2819048..2819111 - 64 NuclAT_20 - -
- 2819048..2819111 - 64 NuclAT_20 - -
- 2819048..2819111 - 64 NuclAT_23 - -
- 2819048..2819111 - 64 NuclAT_23 - -
- 2819048..2819111 - 64 NuclAT_23 - -
- 2819048..2819111 - 64 NuclAT_23 - -
- 2819048..2819111 - 64 NuclAT_26 - -
- 2819048..2819111 - 64 NuclAT_26 - -
- 2819048..2819111 - 64 NuclAT_26 - -
- 2819048..2819111 - 64 NuclAT_26 - -
- 2819048..2819111 - 64 NuclAT_30 - -
- 2819048..2819111 - 64 NuclAT_30 - -
- 2819048..2819111 - 64 NuclAT_30 - -
- 2819048..2819111 - 64 NuclAT_30 - -
- 2819048..2819111 - 64 NuclAT_33 - -
- 2819048..2819111 - 64 NuclAT_33 - -
- 2819048..2819111 - 64 NuclAT_33 - -
- 2819048..2819111 - 64 NuclAT_33 - -
L1O93_RS13890 2819161..2819268 + 108 WP_000170957.1 type I toxin-antitoxin system toxin Ldr family protein -
L1O93_RS13895 2819417..2820271 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
L1O93_RS13900 2820307..2821116 - 810 WP_001257044.1 invasion regulator SirB1 -
L1O93_RS13905 2821120..2821512 - 393 WP_000200378.1 invasion regulator SirB2 -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T232405 WP_000170963.1 NZ_CP091022:2817179-2817286 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T232405 NZ_CP127277:c2836744-2836325 [Mycobacterium tuberculosis]
GTGACGGCACTGCTCGATGTCAATGTGCTGATCGCGCTGGGCTGGCCGAATCACGTTCACCATGCGGCCGCGCAGCGATG
GTTCACGCAGTTCTCCTCGAATGGGTGGGCCACCACGCCGATCACCGAGGCAGGGTATGTCCGAATTTCAAGCAATCGCA
GTGTGATGCAGGTGTCGACCACGCCGGCTATCGCGATCGCTCAGTTGGCGGCGATGACTTCTCTTGCCGGGCACACGTTT
TGGCCTGACGATGTGCCACTGATCGTTGGGAGCGCCGGCGATCGCGATGCGGTGTCCAACCACCGTCGGGTCACCGACTG
CCATCTCATCGCCTTGGCCGCGCGCTACGGGGGCCGGTTGGTCACATTCGATGCCGCACTGGCCGATTCAGCATCCGCAG
GCCTCGTCGAGGTGTTGTAG

Antitoxin


Download         Length: 67 bp

>AT232405 NZ_CP091022:c2817132-2817066 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References