Detailed information of TA system TA232405

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2817066..2817286
• Replicon: chromosome
• Accession: NZ_CP091022
• Organism: Escherichia coli strain STEC276

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: L1O93_RS13880
• Protein ID: WP_000170963.1
• Coordinates: 2817179..2817286 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2817066..2817132 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
L1O93_RS13855	2813389..2813742	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
L1O93_RS13860	2813786..2814481	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
L1O93_RS13865	2814639..2814869	-	231	WP_001146444.1	putative cation transport regulator ChaB	-
L1O93_RS13870	2815139..2816239	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2816529..2816596	-	68	NuclAT_38	-	-
-	2816529..2816596	-	68	NuclAT_38	-	-
-	2816529..2816596	-	68	NuclAT_38	-	-
-	2816529..2816596	-	68	NuclAT_38	-	-
-	2816529..2816596	-	68	NuclAT_41	-	-
-	2816529..2816596	-	68	NuclAT_41	-	-
-	2816529..2816596	-	68	NuclAT_41	-	-
-	2816529..2816596	-	68	NuclAT_41	-	-
-	2816529..2816596	-	68	NuclAT_44	-	-
-	2816529..2816596	-	68	NuclAT_44	-	-
-	2816529..2816596	-	68	NuclAT_44	-	-
-	2816529..2816596	-	68	NuclAT_44	-	-
-	2816529..2816596	-	68	NuclAT_47	-	-
-	2816529..2816596	-	68	NuclAT_47	-	-
-	2816529..2816596	-	68	NuclAT_47	-	-
-	2816529..2816596	-	68	NuclAT_47	-	-
-	2816531..2816596	-	66	NuclAT_18	-	-
-	2816531..2816596	-	66	NuclAT_18	-	-
-	2816531..2816596	-	66	NuclAT_18	-	-
-	2816531..2816596	-	66	NuclAT_18	-	-
-	2816531..2816596	-	66	NuclAT_21	-	-
-	2816531..2816596	-	66	NuclAT_21	-	-
-	2816531..2816596	-	66	NuclAT_21	-	-
-	2816531..2816596	-	66	NuclAT_21	-	-
-	2816531..2816596	-	66	NuclAT_24	-	-
-	2816531..2816596	-	66	NuclAT_24	-	-
-	2816531..2816596	-	66	NuclAT_24	-	-
-	2816531..2816596	-	66	NuclAT_24	-	-
-	2816531..2816596	-	66	NuclAT_27	-	-
-	2816531..2816596	-	66	NuclAT_27	-	-
-	2816531..2816596	-	66	NuclAT_27	-	-
-	2816531..2816596	-	66	NuclAT_27	-	-
-	2816531..2816596	-	66	NuclAT_31	-	-
-	2816531..2816596	-	66	NuclAT_31	-	-
-	2816531..2816596	-	66	NuclAT_31	-	-
-	2816531..2816596	-	66	NuclAT_31	-	-
-	2816531..2816596	-	66	NuclAT_34	-	-
-	2816531..2816596	-	66	NuclAT_34	-	-
-	2816531..2816596	-	66	NuclAT_34	-	-
-	2816531..2816596	-	66	NuclAT_34	-	-
L1O93_RS13875	2816644..2816751	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2817066..2817132	-	67	-	-	Antitoxin
L1O93_RS13880	2817179..2817286	+	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
L1O93_RS13885	2817595..2818964	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	2819046..2819111	-	66	NuclAT_39	-	-
-	2819046..2819111	-	66	NuclAT_39	-	-
-	2819046..2819111	-	66	NuclAT_39	-	-
-	2819046..2819111	-	66	NuclAT_39	-	-
-	2819046..2819111	-	66	NuclAT_42	-	-
-	2819046..2819111	-	66	NuclAT_42	-	-
-	2819046..2819111	-	66	NuclAT_42	-	-
-	2819046..2819111	-	66	NuclAT_42	-	-
-	2819046..2819111	-	66	NuclAT_45	-	-
-	2819046..2819111	-	66	NuclAT_45	-	-
-	2819046..2819111	-	66	NuclAT_45	-	-
-	2819046..2819111	-	66	NuclAT_45	-	-
-	2819046..2819111	-	66	NuclAT_48	-	-
-	2819046..2819111	-	66	NuclAT_48	-	-
-	2819046..2819111	-	66	NuclAT_48	-	-
-	2819046..2819111	-	66	NuclAT_48	-	-
-	2819048..2819111	-	64	NuclAT_17	-	-
-	2819048..2819111	-	64	NuclAT_17	-	-
-	2819048..2819111	-	64	NuclAT_17	-	-
-	2819048..2819111	-	64	NuclAT_17	-	-
-	2819048..2819111	-	64	NuclAT_20	-	-
-	2819048..2819111	-	64	NuclAT_20	-	-
-	2819048..2819111	-	64	NuclAT_20	-	-
-	2819048..2819111	-	64	NuclAT_20	-	-
-	2819048..2819111	-	64	NuclAT_23	-	-
-	2819048..2819111	-	64	NuclAT_23	-	-
-	2819048..2819111	-	64	NuclAT_23	-	-
-	2819048..2819111	-	64	NuclAT_23	-	-
-	2819048..2819111	-	64	NuclAT_26	-	-
-	2819048..2819111	-	64	NuclAT_26	-	-
-	2819048..2819111	-	64	NuclAT_26	-	-
-	2819048..2819111	-	64	NuclAT_26	-	-
-	2819048..2819111	-	64	NuclAT_30	-	-
-	2819048..2819111	-	64	NuclAT_30	-	-
-	2819048..2819111	-	64	NuclAT_30	-	-
-	2819048..2819111	-	64	NuclAT_30	-	-
-	2819048..2819111	-	64	NuclAT_33	-	-
-	2819048..2819111	-	64	NuclAT_33	-	-
-	2819048..2819111	-	64	NuclAT_33	-	-
-	2819048..2819111	-	64	NuclAT_33	-	-
L1O93_RS13890	2819161..2819268	+	108	WP_000170957.1	type I toxin-antitoxin system toxin Ldr family protein	-
L1O93_RS13895	2819417..2820271	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
L1O93_RS13900	2820307..2821116	-	810	WP_001257044.1	invasion regulator SirB1	-
L1O93_RS13905	2821120..2821512	-	393	WP_000200378.1	invasion regulator SirB2	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T232405 WP_000170963.1 NZ_CP091022:2817179-2817286 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T232405 NZ_CP127277:c2836744-2836325 [Mycobacterium tuberculosis]
GTGACGGCACTGCTCGATGTCAATGTGCTGATCGCGCTGGGCTGGCCGAATCACGTTCACCATGCGGCCGCGCAGCGATG
GTTCACGCAGTTCTCCTCGAATGGGTGGGCCACCACGCCGATCACCGAGGCAGGGTATGTCCGAATTTCAAGCAATCGCA
GTGTGATGCAGGTGTCGACCACGCCGGCTATCGCGATCGCTCAGTTGGCGGCGATGACTTCTCTTGCCGGGCACACGTTT
TGGCCTGACGATGTGCCACTGATCGTTGGGAGCGCCGGCGATCGCGATGCGGTGTCCAACCACCGTCGGGTCACCGACTG
CCATCTCATCGCCTTGGCCGCGCGCTACGGGGGCCGGTTGGTCACATTCGATGCCGCACTGGCCGATTCAGCATCCGCAG
GCCTCGTCGAGGTGTTGTAG

Antitoxin

Nucleotide

• Length: 67 bp

>AT232405 NZ_CP091022:c2817132-2817066 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin