Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2816531..2816751 | Replicon | chromosome |
| Accession | NZ_CP091022 | ||
| Organism | Escherichia coli strain STEC276 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | L1O93_RS13875 | Protein ID | WP_000170965.1 |
| Coordinates | 2816644..2816751 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2816531..2816597 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L1O93_RS13850 | 2811809..2813203 | - | 1395 | WP_001400233.1 | inverse autotransporter invasin YchO | - |
| L1O93_RS13855 | 2813389..2813742 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| L1O93_RS13860 | 2813786..2814481 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| L1O93_RS13865 | 2814639..2814869 | - | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| L1O93_RS13870 | 2815139..2816239 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2816531..2816597 | - | 67 | - | - | Antitoxin |
| L1O93_RS13875 | 2816644..2816751 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2817064..2817131 | - | 68 | NuclAT_37 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_37 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_37 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_37 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_40 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_40 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_40 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_40 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_43 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_43 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_43 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_43 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_46 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_46 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_46 | - | - |
| - | 2817064..2817131 | - | 68 | NuclAT_46 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_16 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_16 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_16 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_16 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_19 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_19 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_19 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_19 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_22 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_22 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_22 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_22 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_25 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_25 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_25 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_25 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_29 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_29 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_29 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_29 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_32 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_32 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_32 | - | - |
| - | 2817066..2817131 | - | 66 | NuclAT_32 | - | - |
| L1O93_RS13880 | 2817179..2817286 | + | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| L1O93_RS13885 | 2817595..2818964 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 2819046..2819111 | - | 66 | NuclAT_39 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_39 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_39 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_39 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_42 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_42 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_42 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_42 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_45 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_45 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_45 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_45 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_48 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_48 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_48 | - | - |
| - | 2819046..2819111 | - | 66 | NuclAT_48 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_17 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_17 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_17 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_17 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_20 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_20 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_20 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_20 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_23 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_23 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_23 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_23 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_26 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_26 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_26 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_26 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_30 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_30 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_30 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_30 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_33 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_33 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_33 | - | - |
| - | 2819048..2819111 | - | 64 | NuclAT_33 | - | - |
| L1O93_RS13890 | 2819161..2819268 | + | 108 | WP_000170957.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| L1O93_RS13895 | 2819417..2820271 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| L1O93_RS13900 | 2820307..2821116 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| L1O93_RS13905 | 2821120..2821512 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T232404 WP_000170965.1 NZ_CP091022:2816644-2816751 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T232404 NZ_CP127277:2790368-2790793 [Mycobacterium tuberculosis]
GTGGCGCTGCTCGACGTCAACGCATTGGTCGCGCTGGCGTGGGACTCACACATCCACCACGCCCGGATCCGCGAGTGGTT
TACCGCCAACGCCACGCTCGGCTGGGCGACTTGCCCGCTCACCGAAGCCGGCTTCGTGCGGGCGTCGACGAACCCAAAAG
TACTTCCCAGCGCGATCGGGATCGCAGACGCTCGACGGGTCCTCGTGGCACTACGCGCCGTGGGAGGCCACCGCTTCCTG
GCTGACGACGTATCGCTCGTCGATGACGATGTTCCGTTGATCGTCGGTTATCGCCAGGTGACCGACGCCCATCTGCTGAC
ACTCGCCCGCCGGCGCGGCGTCCGCCTGGTCACCTTCGACGCCGGTGTCTTCACCCTCGCCCAACAACGCCCCAAGACGC
CAGTGGAGCTGCTGACCATCCTCTAA
GTGGCGCTGCTCGACGTCAACGCATTGGTCGCGCTGGCGTGGGACTCACACATCCACCACGCCCGGATCCGCGAGTGGTT
TACCGCCAACGCCACGCTCGGCTGGGCGACTTGCCCGCTCACCGAAGCCGGCTTCGTGCGGGCGTCGACGAACCCAAAAG
TACTTCCCAGCGCGATCGGGATCGCAGACGCTCGACGGGTCCTCGTGGCACTACGCGCCGTGGGAGGCCACCGCTTCCTG
GCTGACGACGTATCGCTCGTCGATGACGATGTTCCGTTGATCGTCGGTTATCGCCAGGTGACCGACGCCCATCTGCTGAC
ACTCGCCCGCCGGCGCGGCGTCCGCCTGGTCACCTTCGACGCCGGTGTCTTCACCCTCGCCCAACAACGCCCCAAGACGC
CAGTGGAGCTGCTGACCATCCTCTAA
Antitoxin
Download Length: 67 bp
>AT232404 NZ_CP091022:c2816597-2816531 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGGTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGGTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|