Detailed information of TA system TA232022

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 292189..292603
• Replicon: chromosome
• Accession: NZ_CP090879
• Organism: Staphylococcus aureus strain SAUR_BFS2

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: L1A04_RS01490
• Protein ID: WP_168768259.1
• Coordinates: 292352..292603 (-)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: L1A04_RS01485
• Protein ID: WP_168777632.1
• Coordinates: 292189..292362 (-)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
L1A04_RS01435 (288076)	288076..289353	-	1278	WP_031929822.1	PBSX family phage terminase large subunit	-
L1A04_RS01440 (289340)	289340..289780	-	441	WP_001003271.1	terminase small subunit	-
L1A04_RS01445 (289967)	289967..290386	-	420	WP_000058634.1	transcriptional regulator	-
L1A04_RS01450 (290401)	290401..290547	-	147	WP_000989997.1	hypothetical protein	-
L1A04_RS01455 (290548)	290548..290721	-	174	WP_070014293.1	transcriptional activator RinB	-
L1A04_RS01460 (290718)	290718..290924	-	207	WP_054189015.1	DUF1381 domain-containing protein	-
L1A04_RS01465 (290921)	290921..291166	-	246	WP_000120373.1	hypothetical protein	-
L1A04_RS01470 (291203)	291203..291730	-	528	WP_117216027.1	dUTPase	-
L1A04_RS01475 (291745)	291745..291906	-	162	WP_168777631.1	hypothetical protein	-
L1A04_RS01480 (291907)	291907..292188	-	282	WP_147701981.1	hypothetical protein	-
L1A04_RS01485 (292189)	292189..292362	-	174	WP_168777632.1	hypothetical protein	Antitoxin
L1A04_RS01490 (292352)	292352..292603	-	252	WP_168768259.1	DUF1024 family protein	Toxin
L1A04_RS01495 (292596)	292596..292904	-	309	WP_234865607.1	hypothetical protein	-
L1A04_RS01500 (292901)	292901..293248	-	348	WP_000979209.1	YopX family protein	-
L1A04_RS01505 (293245)	293245..293646	-	402	WP_000695762.1	hypothetical protein	-
L1A04_RS01510 (293660)	293660..293902	-	243	WP_000131370.1	SAV1978 family virulence-associated passenger protein	-
L1A04_RS01515 (293906)	293906..294274	-	369	WP_234877983.1	SA1788 family PVL leukocidin-associated protein	-
L1A04_RS01520 (294287)	294287..294691	-	405	WP_058342511.1	RusA family crossover junction endodeoxyribonuclease	-
L1A04_RS01525 (294700)	294700..294918	-	219	WP_000338530.1	hypothetical protein	-
L1A04_RS01530 (294925)	294925..295809	-	885	WP_234865610.1	DnaD domain protein	-
L1A04_RS01535 (295839)	295839..296309	-	471	WP_033842379.1	single-stranded DNA-binding protein	-
L1A04_RS01540 (296310)	296310..296927	-	618	WP_073394849.1	MBL fold metallo-hydrolase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	263945..307985	44040

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-81)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9303.23 Da
• Isoelectric Point: 3.9756

>T232022 WP_168768259.1 NZ_CP090879:c292603-292352 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMAGQVVYKYEEEQG
NDY

Nucleotide

• Length: 252 bp

>T232022 NZ_CP127177:c301529-301434 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACAAGGAATAA

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6482.32 Da
• Isoelectric Point: 4.2484

>AT232022 WP_168777632.1 NZ_CP090879:c292362-292189 [Staphylococcus aureus]
MTISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp

>AT232022 NZ_CP127177:301335-301399 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT