Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2527358..2527542 | Replicon | chromosome |
| Accession | NZ_CP090876 | ||
| Organism | Staphylococcus aureus strain SAUR_BFS12 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2K4AFL5 |
| Locus tag | L0998_RS12320 | Protein ID | WP_000482651.1 |
| Coordinates | 2527358..2527465 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2527482..2527542 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L0998_RS12295 | 2522725..2523198 | + | 474 | WP_054189920.1 | GyrI-like domain-containing protein | - |
| L0998_RS12300 | 2523322..2524533 | - | 1212 | WP_054189921.1 | multidrug effflux MFS transporter | - |
| L0998_RS12305 | 2524715..2525368 | - | 654 | WP_054189922.1 | hypothetical protein | - |
| L0998_RS12310 | 2525428..2526570 | - | 1143 | WP_054189923.1 | glycerate kinase | - |
| L0998_RS12315 | 2526838..2527224 | + | 387 | WP_054189924.1 | flippase GtxA | - |
| L0998_RS12320 | 2527358..2527465 | + | 108 | WP_000482651.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2527482..2527542 | - | 61 | - | - | Antitoxin |
| L0998_RS12325 | 2527652..2527819 | + | 168 | Protein_2385 | hypothetical protein | - |
| L0998_RS12330 | 2527874..2528560 | + | 687 | WP_054189925.1 | dethiobiotin synthase | - |
| L0998_RS12335 | 2528538..2529896 | + | 1359 | WP_054189926.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| L0998_RS12340 | 2529898..2530905 | + | 1008 | WP_001046647.1 | biotin synthase BioB | - |
| L0998_RS12345 | 2530883..2531998 | + | 1116 | WP_054189927.1 | pyridoxal phosphate-dependent aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3984.75 Da Isoelectric Point: 11.0582
>T232000 WP_000482651.1 NZ_CP090876:2527358-2527465 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
Download Length: 108 bp
>T232000 NZ_CP127153:2008172-2008274 [Klebsiella pneumoniae subsp. pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT232000 NZ_CP090876:c2527542-2527482 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|