Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF2/- |
| Location | 441267..441574 | Replicon | chromosome |
| Accession | NZ_CP090876 | ||
| Organism | Staphylococcus aureus strain SAUR_BFS12 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | L0998_RS02515 | Protein ID | WP_077446684.1 |
| Coordinates | 441267..441443 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 441433..441574 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L0998_RS02495 | 436485..440270 | + | 3786 | WP_000582158.1 | phage tail spike protein | - |
| L0998_RS02500 | 440260..440412 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| L0998_RS02505 | 440459..440746 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| L0998_RS02510 | 440804..441115 | + | 312 | WP_054190602.1 | DUF2951 family protein | - |
| L0998_RS02515 | 441267..441443 | + | 177 | WP_077446684.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 441433..441574 | - | 142 | - | - | Antitoxin |
| L0998_RS02525 | 441655..441909 | + | 255 | WP_000611512.1 | phage holin | - |
| L0998_RS02530 | 441921..442676 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| L0998_RS02535 | 442867..443358 | + | 492 | WP_000919350.1 | staphylokinase | - |
| L0998_RS02540 | 444008..444343 | + | 336 | Protein_456 | SH3 domain-containing protein | - |
| L0998_RS02545 | 444853..445203 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| L0998_RS02550 | 445256..445516 | - | 261 | WP_001791826.1 | hypothetical protein | - |
| L0998_RS02555 | 445827..446006 | - | 180 | WP_000669789.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD / sak / scn | 382615..445203 | 62588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6844.44 Da Isoelectric Point: 9.9479
>T231995 WP_077446684.1 NZ_CP090876:441267-441443 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKFIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKFIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 142 bp
>AT231995 NZ_CP090876:c441574-441433 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTTAT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTTAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|