Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4545231..4545452 | Replicon | chromosome |
Accession | NC_011353 | ||
Organism | Escherichia coli O157:H7 str. EC4115 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | ECH74115_RS33210 | Protein ID | WP_001295224.1 |
Coordinates | 4545231..4545338 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4545387..4545452 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECH74115_RS24315 | 4540484..4541236 | - | 753 | Protein_4498 | cellulose biosynthesis protein BcsQ | - |
ECH74115_RS24325 | 4541248..4541436 | - | 189 | WP_001063316.1 | YhjR family protein | - |
ECH74115_RS24330 | 4541709..4543280 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
ECH74115_RS24335 | 4543277..4543468 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
ECH74115_RS24340 | 4543465..4545144 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
ECH74115_RS33210 | 4545231..4545338 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4545387..4545452 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4545387..4545452 | + | 66 | NuclAT_21 | - | Antitoxin |
ECH74115_RS24355 | 4545814..4547085 | + | 1272 | WP_001301684.1 | amino acid permease | - |
ECH74115_RS24360 | 4547115..4548119 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
ECH74115_RS24365 | 4548116..4549099 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
ECH74115_RS24370 | 4549110..4550012 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T23167 WP_001295224.1 NC_011353:c4545338-4545231 [Escherichia coli O157:H7 str. EC4115]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T23167 NC_011353:c4545338-4545231 [Escherichia coli O157:H7 str. EC4115]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT23167 NC_011353:4545387-4545452 [Escherichia coli O157:H7 str. EC4115]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|