Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2923474..2923699 | Replicon | chromosome |
| Accession | NC_011353 | ||
| Organism | Escherichia coli O157:H7 str. EC4115 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | ECH74115_RS15935 | Protein ID | WP_000813254.1 |
| Coordinates | 2923474..2923629 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2923641..2923699 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECH74115_RS15900 | 2918759..2919817 | - | 1059 | WP_000483509.1 | site-specific DNA-methyltransferase | - |
| ECH74115_RS15905 | 2919968..2920165 | - | 198 | WP_000917735.1 | hypothetical protein | - |
| ECH74115_RS15910 | 2920392..2921213 | - | 822 | WP_000762902.1 | antitermination protein | - |
| ECH74115_RS15915 | 2921210..2921584 | - | 375 | WP_000904171.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ECH74115_RS15920 | 2921597..2922646 | - | 1050 | WP_001265156.1 | DUF968 domain-containing protein | - |
| ECH74115_RS32960 | 2922648..2922926 | - | 279 | WP_012779355.1 | hypothetical protein | - |
| ECH74115_RS15930 | 2922996..2923253 | - | 258 | WP_001217394.1 | hypothetical protein | - |
| ECH74115_RS15935 | 2923474..2923629 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2923641..2923699 | + | 59 | - | - | Antitoxin |
| ECH74115_RS32965 | 2923875..2923979 | - | 105 | WP_001278450.1 | hypothetical protein | - |
| ECH74115_RS15940 | 2924095..2924457 | - | 363 | WP_000610377.1 | DUF551 domain-containing protein | - |
| ECH74115_RS15945 | 2924454..2924825 | - | 372 | WP_000137941.1 | hypothetical protein | - |
| ECH74115_RS15950 | 2924861..2925073 | - | 213 | WP_000063625.1 | hypothetical protein | - |
| ECH74115_RS15955 | 2925122..2925478 | - | 357 | WP_001302146.1 | hypothetical protein | - |
| ECH74115_RS15960 | 2925535..2925930 | - | 396 | WP_001118161.1 | DUF977 family protein | - |
| ECH74115_RS15965 | 2925946..2926716 | - | 771 | WP_000537576.1 | DUF1627 domain-containing protein | - |
| ECH74115_RS34070 | 2926751..2927293 | - | 543 | WP_157837342.1 | replication protein | - |
| ECH74115_RS34075 | 2927205..2928245 | - | 1041 | WP_000020570.1 | DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ospG | 2892265..2985110 | 92845 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T23157 WP_000813254.1 NC_011353:c2923629-2923474 [Escherichia coli O157:H7 str. EC4115]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T23157 NC_011353:c2923629-2923474 [Escherichia coli O157:H7 str. EC4115]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT23157 NC_011353:2923641-2923699 [Escherichia coli O157:H7 str. EC4115]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|