Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2101953..2102178 | Replicon | chromosome |
Accession | NC_011353 | ||
Organism | Escherichia coli O157:H7 str. EC4115 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ECH74115_RS11270 | Protein ID | WP_000813258.1 |
Coordinates | 2101953..2102108 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2102120..2102178 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECH74115_RS11220 | 2096956..2097387 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
ECH74115_RS11235 | 2097838..2098551 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ECH74115_RS33815 | 2098687..2098884 | - | 198 | WP_000917763.1 | hypothetical protein | - |
ECH74115_RS11245 | 2099109..2099663 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
ECH74115_RS11250 | 2099726..2100031 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
ECH74115_RS11255 | 2100044..2101093 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ECH74115_RS11260 | 2101095..2101367 | - | 273 | WP_000191872.1 | hypothetical protein | - |
ECH74115_RS11265 | 2101489..2101833 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ECH74115_RS11270 | 2101953..2102108 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2102120..2102178 | + | 59 | - | - | Antitoxin |
ECH74115_RS11275 | 2102399..2102956 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
ECH74115_RS11280 | 2102958..2103176 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
ECH74115_RS11285 | 2103304..2103615 | - | 312 | WP_001289673.1 | hypothetical protein | - |
ECH74115_RS11290 | 2103608..2103835 | - | 228 | WP_000699809.1 | hypothetical protein | - |
ECH74115_RS11295 | 2103832..2104113 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
ECH74115_RS11300 | 2104146..2104862 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
ECH74115_RS33820 | 2104896..2105357 | - | 462 | WP_000139447.1 | replication protein | - |
ECH74115_RS33825 | 2105350..2106393 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
ECH74115_RS11315 | 2106462..2106887 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
ECH74115_RS11320 | 2106871..2107113 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2075432..2163590 | 88158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T23146 WP_000813258.1 NC_011353:c2102108-2101953 [Escherichia coli O157:H7 str. EC4115]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T23146 NC_011353:c2102108-2101953 [Escherichia coli O157:H7 str. EC4115]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT23146 NC_011353:2102120-2102178 [Escherichia coli O157:H7 str. EC4115]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|