Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1748700..1748925 | Replicon | chromosome |
Accession | NC_011353 | ||
Organism | Escherichia coli O157:H7 str. EC4115 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | ECH74115_RS09520 | Protein ID | WP_000813254.1 |
Coordinates | 1748770..1748925 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1748700..1748758 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECH74115_RS33735 | 1744154..1745194 | + | 1041 | WP_000020570.1 | DNA-binding protein | - |
ECH74115_RS33740 | 1745106..1745648 | + | 543 | WP_157837342.1 | replication protein | - |
ECH74115_RS09490 | 1745683..1746453 | + | 771 | WP_000537576.1 | DUF1627 domain-containing protein | - |
ECH74115_RS09495 | 1746469..1746864 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
ECH74115_RS09500 | 1746921..1747277 | + | 357 | WP_001302146.1 | hypothetical protein | - |
ECH74115_RS09505 | 1747326..1747538 | + | 213 | WP_000063625.1 | hypothetical protein | - |
ECH74115_RS09510 | 1747574..1747945 | + | 372 | WP_000137941.1 | hypothetical protein | - |
ECH74115_RS09515 | 1747942..1748304 | + | 363 | WP_000610377.1 | DUF551 domain-containing protein | - |
ECH74115_RS32690 | 1748420..1748524 | + | 105 | WP_001278450.1 | hypothetical protein | - |
- | 1748700..1748758 | - | 59 | - | - | Antitoxin |
ECH74115_RS09520 | 1748770..1748925 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
ECH74115_RS09525 | 1749146..1749403 | + | 258 | WP_001217394.1 | hypothetical protein | - |
ECH74115_RS32695 | 1749473..1749751 | + | 279 | WP_012779355.1 | hypothetical protein | - |
ECH74115_RS09535 | 1749753..1750802 | + | 1050 | WP_001265156.1 | DUF968 domain-containing protein | - |
ECH74115_RS09540 | 1750815..1751189 | + | 375 | WP_000904171.1 | RusA family crossover junction endodeoxyribonuclease | - |
ECH74115_RS09545 | 1751186..1752007 | + | 822 | WP_000762902.1 | antitermination protein | - |
ECH74115_RS09550 | 1752234..1752431 | + | 198 | WP_000917735.1 | hypothetical protein | - |
ECH74115_RS09555 | 1752582..1753640 | + | 1059 | WP_000483509.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T23143 WP_000813254.1 NC_011353:1748770-1748925 [Escherichia coli O157:H7 str. EC4115]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T23143 NC_011353:1748770-1748925 [Escherichia coli O157:H7 str. EC4115]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT23143 NC_011353:c1748758-1748700 [Escherichia coli O157:H7 str. EC4115]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|