Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1636545..1636766 Replicon chromosome
Accession NC_011353
Organism Escherichia coli O157:H7 str. EC4115

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag ECH74115_RS08850 Protein ID WP_000170954.1
Coordinates 1636545..1636652 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1636705..1636766 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECH74115_RS08825 1632390..1633472 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECH74115_RS08830 1633472..1634305 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECH74115_RS08835 1634302..1634694 + 393 WP_000200379.1 invasion regulator SirB2 -
ECH74115_RS08840 1634698..1635507 + 810 WP_001257044.1 invasion regulator SirB1 -
ECH74115_RS08845 1635543..1636397 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
ECH74115_RS08850 1636545..1636652 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1636705..1636766 + 62 NuclAT_24 - Antitoxin
- 1636705..1636766 + 62 NuclAT_24 - Antitoxin
- 1636705..1636766 + 62 NuclAT_24 - Antitoxin
- 1636705..1636766 + 62 NuclAT_24 - Antitoxin
- 1636705..1636766 + 62 NuclAT_26 - Antitoxin
- 1636705..1636766 + 62 NuclAT_26 - Antitoxin
- 1636705..1636766 + 62 NuclAT_26 - Antitoxin
- 1636705..1636766 + 62 NuclAT_26 - Antitoxin
- 1636705..1636766 + 62 NuclAT_28 - Antitoxin
- 1636705..1636766 + 62 NuclAT_28 - Antitoxin
- 1636705..1636766 + 62 NuclAT_28 - Antitoxin
- 1636705..1636766 + 62 NuclAT_28 - Antitoxin
- 1636705..1636766 + 62 NuclAT_30 - Antitoxin
- 1636705..1636766 + 62 NuclAT_30 - Antitoxin
- 1636705..1636766 + 62 NuclAT_30 - Antitoxin
- 1636705..1636766 + 62 NuclAT_30 - Antitoxin
- 1636705..1636766 + 62 NuclAT_32 - Antitoxin
- 1636705..1636766 + 62 NuclAT_32 - Antitoxin
- 1636705..1636766 + 62 NuclAT_32 - Antitoxin
- 1636705..1636766 + 62 NuclAT_32 - Antitoxin
- 1636705..1636767 + 63 NuclAT_17 - -
- 1636705..1636767 + 63 NuclAT_17 - -
- 1636705..1636767 + 63 NuclAT_17 - -
- 1636705..1636767 + 63 NuclAT_17 - -
- 1636705..1636767 + 63 NuclAT_18 - -
- 1636705..1636767 + 63 NuclAT_18 - -
- 1636705..1636767 + 63 NuclAT_18 - -
- 1636705..1636767 + 63 NuclAT_18 - -
- 1636705..1636767 + 63 NuclAT_19 - -
- 1636705..1636767 + 63 NuclAT_19 - -
- 1636705..1636767 + 63 NuclAT_19 - -
- 1636705..1636767 + 63 NuclAT_19 - -
- 1636705..1636767 + 63 NuclAT_20 - -
- 1636705..1636767 + 63 NuclAT_20 - -
- 1636705..1636767 + 63 NuclAT_20 - -
- 1636705..1636767 + 63 NuclAT_20 - -
- 1636705..1636767 + 63 NuclAT_22 - -
- 1636705..1636767 + 63 NuclAT_22 - -
- 1636705..1636767 + 63 NuclAT_22 - -
- 1636705..1636767 + 63 NuclAT_22 - -
- 1636705..1636767 + 63 NuclAT_23 - -
- 1636705..1636767 + 63 NuclAT_23 - -
- 1636705..1636767 + 63 NuclAT_23 - -
- 1636705..1636767 + 63 NuclAT_23 - -
ECH74115_RS08855 1637081..1637188 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1637236..1637295 + 60 NuclAT_25 - -
- 1637236..1637295 + 60 NuclAT_25 - -
- 1637236..1637295 + 60 NuclAT_25 - -
- 1637236..1637295 + 60 NuclAT_25 - -
- 1637236..1637295 + 60 NuclAT_27 - -
- 1637236..1637295 + 60 NuclAT_27 - -
- 1637236..1637295 + 60 NuclAT_27 - -
- 1637236..1637295 + 60 NuclAT_27 - -
- 1637236..1637295 + 60 NuclAT_29 - -
- 1637236..1637295 + 60 NuclAT_29 - -
- 1637236..1637295 + 60 NuclAT_29 - -
- 1637236..1637295 + 60 NuclAT_29 - -
- 1637236..1637295 + 60 NuclAT_31 - -
- 1637236..1637295 + 60 NuclAT_31 - -
- 1637236..1637295 + 60 NuclAT_31 - -
- 1637236..1637295 + 60 NuclAT_31 - -
- 1637236..1637295 + 60 NuclAT_33 - -
- 1637236..1637295 + 60 NuclAT_33 - -
- 1637236..1637295 + 60 NuclAT_33 - -
- 1637236..1637295 + 60 NuclAT_33 - -
ECH74115_RS08860 1637587..1638687 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ECH74115_RS08865 1638957..1639187 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECH74115_RS08870 1639348..1640043 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ECH74115_RS08875 1640087..1640440 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T23137 WP_000170954.1 NC_011353:c1636652-1636545 [Escherichia coli O157:H7 str. EC4115]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T23137 NC_011353:c1636652-1636545 [Escherichia coli O157:H7 str. EC4115]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT23137 NC_011353:1636705-1636766 [Escherichia coli O157:H7 str. EC4115]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References