Detailed information of TA system TA231251

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 51078..51347
• Replicon: plasmid pBY63-2
• Accession: NZ_CP090572
• Organism: Escherichia coli strain BY63

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LZE53_RS24185
• Protein ID: WP_001372321.1
• Coordinates: 51222..51347 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	51078..51143 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LZE53_RS24145	46080..46322	+	243	WP_001365577.1	hypothetical protein	-
LZE53_RS24150	46792..47319	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
LZE53_RS24155	47375..47608	+	234	WP_000006004.1	DUF905 domain-containing protein	-
LZE53_RS24160	47667..49690	+	2024	Protein_59	ParB/RepB/Spo0J family partition protein	-
LZE53_RS24165	49759..50193	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
LZE53_RS24170	50190..50952	+	763	Protein_61	plasmid SOS inhibition protein A	-
-	50921..51145	+	225	NuclAT_0	-	-
-	50921..51145	+	225	NuclAT_0	-	-
-	50921..51145	+	225	NuclAT_0	-	-
-	50921..51145	+	225	NuclAT_0	-	-
LZE53_RS24175	50930..51109	-	180	WP_001309233.1	hypothetical protein	-
-	51078..51143	-	66	-	-	Antitoxin
LZE53_RS24180	51131..51280	+	150	Protein_63	plasmid maintenance protein Mok	-
LZE53_RS24185	51222..51347	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LZE53_RS24190	51666..51962	-	297	Protein_65	hypothetical protein	-
LZE53_RS24195	52262..52558	+	297	WP_001272251.1	hypothetical protein	-
LZE53_RS24200	52669..53490	+	822	WP_001234445.1	DUF932 domain-containing protein	-
LZE53_RS24205	53787..54377	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
LZE53_RS24210	54712..55095	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LZE53_RS24215	55289..55960	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
LZE53_RS24220	56097..56324	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T231251 WP_001372321.1 NZ_CP090572:51222-51347 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T231251 NZ_CP126166:c4342891-4342788 [Salmonella enterica subsp. enterica]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 66 bp

>AT231251 NZ_CP090572:c51143-51078 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin