Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34015..34279 | Replicon | plasmid p3 |
| Accession | NZ_CP090532 | ||
| Organism | Salmonella enterica strain 2008079-SE | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | L0F60_RS25770 | Protein ID | WP_001303307.1 |
| Coordinates | 34015..34167 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 34217..34279 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L0F60_RS25745 (29218) | 29218..31386 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
| L0F60_RS25750 (31462) | 31462..32076 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| L0F60_RS25755 (32174) | 32174..32383 | + | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| L0F60_RS25760 (32592) | 32592..32768 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (33254) | 33254..33305 | + | 52 | NuclAT_2 | - | - |
| - (33254) | 33254..33305 | + | 52 | NuclAT_2 | - | - |
| - (33254) | 33254..33305 | + | 52 | NuclAT_2 | - | - |
| - (33254) | 33254..33305 | + | 52 | NuclAT_2 | - | - |
| L0F60_RS25765 (33692) | 33692..33943 | + | 252 | WP_001291968.1 | hypothetical protein | - |
| L0F60_RS25770 (34015) | 34015..34167 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (34217) | 34217..34279 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (34217) | 34217..34279 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (34217) | 34217..34279 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (34217) | 34217..34279 | + | 63 | NuclAT_0 | - | Antitoxin |
| L0F60_RS25775 (34794) | 34794..35573 | + | 780 | WP_275450201.1 | protein FinQ | - |
| - (35640) | 35640..35700 | + | 61 | NuclAT_1 | - | - |
| - (35640) | 35640..35700 | + | 61 | NuclAT_1 | - | - |
| - (35640) | 35640..35700 | + | 61 | NuclAT_1 | - | - |
| - (35640) | 35640..35700 | + | 61 | NuclAT_1 | - | - |
| L0F60_RS25780 (35880) | 35880..37088 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| L0F60_RS25785 (37107) | 37107..38177 | + | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..93407 | 93407 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T231038 WP_001303307.1 NZ_CP090532:c34167-34015 [Salmonella enterica]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T231038 NZ_CP125897:c2489527-2489420 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 63 bp
>AT231038 NZ_CP090532:34217-34279 [Salmonella enterica]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
