Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30832..31096 | Replicon | plasmid pPIB-1 |
| Accession | NZ_CP090403 | ||
| Organism | Shigella sp. PIB | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | LXH19_RS22515 | Protein ID | WP_001303307.1 |
| Coordinates | 30832..30984 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 31034..31096 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LXH19_RS22485 (26116) | 26116..26778 | + | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| LXH19_RS22490 (26850) | 26850..27059 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| LXH19_RS22495 (27450) | 27450..27626 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (28112) | 28112..28163 | + | 52 | NuclAT_1 | - | - |
| - (28112) | 28112..28163 | + | 52 | NuclAT_1 | - | - |
| - (28112) | 28112..28163 | + | 52 | NuclAT_1 | - | - |
| - (28112) | 28112..28163 | + | 52 | NuclAT_1 | - | - |
| LXH19_RS22500 (28347) | 28347..29369 | + | 1023 | WP_001572805.1 | IS21-like element IS100 family transposase | - |
| LXH19_RS22505 (29366) | 29366..30148 | + | 783 | WP_001300609.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| LXH19_RS22510 (30509) | 30509..30760 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| LXH19_RS22515 (30832) | 30832..30984 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (31034) | 31034..31096 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (31034) | 31034..31096 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (31034) | 31034..31096 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (31034) | 31034..31096 | + | 63 | NuclAT_0 | - | Antitoxin |
| LXH19_RS22520 (31276) | 31276..32484 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| LXH19_RS22525 (32503) | 32503..33573 | + | 1071 | WP_000151575.1 | IncI1-type conjugal transfer protein TrbB | - |
| LXH19_RS22530 (33566) | 33566..35857 | + | 2292 | WP_001289271.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-2 | - | 1..98997 | 98997 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T230677 WP_001303307.1 NZ_CP090403:c30984-30832 [Shigella sp. PIB]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T230677 NZ_CP125310:c3052625-3052522 [Citrobacter freundii]
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 63 bp
>AT230677 NZ_CP090403:31034-31096 [Shigella sp. PIB]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|