Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 30832..31096 Replicon plasmid pPIB-1
Accession NZ_CP090403
Organism Shigella sp. PIB

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag LXH19_RS22515 Protein ID WP_001303307.1
Coordinates 30832..30984 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 31034..31096 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LXH19_RS22485 (26116) 26116..26778 + 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -
LXH19_RS22490 (26850) 26850..27059 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
LXH19_RS22495 (27450) 27450..27626 + 177 WP_001054900.1 hypothetical protein -
- (28112) 28112..28163 + 52 NuclAT_1 - -
- (28112) 28112..28163 + 52 NuclAT_1 - -
- (28112) 28112..28163 + 52 NuclAT_1 - -
- (28112) 28112..28163 + 52 NuclAT_1 - -
LXH19_RS22500 (28347) 28347..29369 + 1023 WP_001572805.1 IS21-like element IS100 family transposase -
LXH19_RS22505 (29366) 29366..30148 + 783 WP_001300609.1 IS21-like element IS100kyp family helper ATPase IstB -
LXH19_RS22510 (30509) 30509..30760 + 252 WP_001291965.1 hypothetical protein -
LXH19_RS22515 (30832) 30832..30984 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (31034) 31034..31096 + 63 NuclAT_0 - Antitoxin
- (31034) 31034..31096 + 63 NuclAT_0 - Antitoxin
- (31034) 31034..31096 + 63 NuclAT_0 - Antitoxin
- (31034) 31034..31096 + 63 NuclAT_0 - Antitoxin
LXH19_RS22520 (31276) 31276..32484 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
LXH19_RS22525 (32503) 32503..33573 + 1071 WP_000151575.1 IncI1-type conjugal transfer protein TrbB -
LXH19_RS22530 (33566) 33566..35857 + 2292 WP_001289271.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCMY-2 - 1..98997 98997


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T230677 WP_001303307.1 NZ_CP090403:c30984-30832 [Shigella sp. PIB]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

>T230677 NZ_CP125310:c3052625-3052522 [Citrobacter freundii]
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 63 bp

>AT230677 NZ_CP090403:31034-31096 [Shigella sp. PIB]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References