Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2551532..2551701 | Replicon | chromosome |
Accession | NZ_CP090375 | ||
Organism | Staphylococcus aureus strain GD4SA108-1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | LZ178_RS12505 | Protein ID | WP_224719344.1 |
Coordinates | 2551609..2551701 (-) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2551532..2551592 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZ178_RS12490 (LZ178_12470) | 2546986..2547153 | - | 168 | WP_001798790.1 | hypothetical protein | - |
LZ178_RS12495 (LZ178_12475) | 2547384..2549117 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
LZ178_RS12500 (LZ178_12480) | 2549142..2550905 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
- | 2551532..2551592 | + | 61 | - | - | Antitoxin |
LZ178_RS12505 (LZ178_12485) | 2551609..2551701 | - | 93 | WP_224719344.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
LZ178_RS12510 (LZ178_12490) | 2551850..2552236 | - | 387 | WP_000779355.1 | flippase GtxA | - |
LZ178_RS12515 (LZ178_12495) | 2552503..2553645 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
LZ178_RS12520 (LZ178_12500) | 2553705..2554364 | + | 660 | WP_000831300.1 | hypothetical protein | - |
LZ178_RS12525 (LZ178_12505) | 2554552..2555763 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
LZ178_RS12530 (LZ178_12510) | 2555886..2556359 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3393.97 Da Isoelectric Point: 10.4935
>T230510 WP_224719344.1 NZ_CP090375:c2551701-2551609 [Staphylococcus aureus]
IDIMTSALSGCLVAFFAHWLRTRNNKKGDK
IDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 93 bp
>T230510 NZ_CP124914:c295959-295864 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 61 bp
>AT230510 NZ_CP090375:2551532-2551592 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|