Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 2254522..2254720 | Replicon | chromosome |
| Accession | NZ_CP090375 | ||
| Organism | Staphylococcus aureus strain GD4SA108-1 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | LZ178_RS10950 | Protein ID | WP_001802298.1 |
| Coordinates | 2254616..2254720 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2254522..2254560 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ178_RS10925 (LZ178_10905) | 2250642..2251307 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
| LZ178_RS10930 (LZ178_10910) | 2251459..2251779 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| LZ178_RS10935 (LZ178_10915) | 2251781..2252761 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| LZ178_RS10940 (LZ178_10920) | 2253027..2254118 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
| LZ178_RS10945 (LZ178_10925) | 2254502..2254576 | + | 75 | Protein_2115 | hypothetical protein | - |
| - | 2254522..2254560 | + | 39 | - | - | Antitoxin |
| LZ178_RS10950 (LZ178_10930) | 2254616..2254720 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| LZ178_RS10955 (LZ178_10935) | 2255400..2255558 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| LZ178_RS10960 (LZ178_10940) | 2255994..2256086 | + | 93 | WP_000220902.1 | hypothetical protein | - |
| LZ178_RS10965 (LZ178_10945) | 2256216..2257073 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
| LZ178_RS10970 (LZ178_10950) | 2257141..2257923 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| LZ178_RS10975 (LZ178_10955) | 2258213..2258821 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T230509 WP_001802298.1 NZ_CP090375:c2254720-2254616 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T230509 NZ_CP124913:2760422-2760517 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 39 bp
>AT230509 NZ_CP090375:2254522-2254560 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|