Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 2858737..2859282 | Replicon | chromosome |
Accession | NZ_CP089932 | ||
Organism | Erwinia tracheiphila strain BHKY |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | LU633_RS15105 | Protein ID | WP_232426821.1 |
Coordinates | 2858737..2858937 (-) | Length | 67 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A0M2KC92 |
Locus tag | LU633_RS15110 | Protein ID | WP_016189579.1 |
Coordinates | 2859022..2859282 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU633_RS15070 (LU633_15070) | 2854074..2854747 | + | 674 | Protein_2966 | IS1 family transposase | - |
LU633_RS15075 (LU633_15075) | 2855653..2856276 | + | 624 | WP_016189571.1 | hypothetical protein | - |
LU633_RS15080 (LU633_15080) | 2856319..2856729 | + | 411 | WP_016189572.1 | lysozyme inhibitor LprI family protein | - |
LU633_RS15085 (LU633_15085) | 2856789..2857205 | + | 417 | WP_016189573.1 | hypothetical protein | - |
LU633_RS15090 (LU633_15090) | 2857400..2857735 | + | 336 | WP_016189574.1 | hypothetical protein | - |
LU633_RS15095 (LU633_15095) | 2857850..2858360 | + | 511 | Protein_2971 | DUF2778 domain-containing protein | - |
LU633_RS15100 (LU633_15100) | 2858338..2858613 | + | 276 | WP_016189577.1 | hypothetical protein | - |
LU633_RS15105 (LU633_15105) | 2858737..2858937 | - | 201 | WP_232426821.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
LU633_RS15110 (LU633_15110) | 2859022..2859282 | - | 261 | WP_016189579.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LU633_RS15115 (LU633_15115) | 2859428..2859601 | + | 174 | WP_016189580.1 | hypothetical protein | - |
LU633_RS15120 (LU633_15120) | 2860112..2861095 | + | 984 | WP_232426796.1 | hypothetical protein | - |
LU633_RS15125 (LU633_15125) | 2861174..2861362 | + | 189 | WP_232426797.1 | hypothetical protein | - |
LU633_RS15130 (LU633_15130) | 2861377..2862498 | + | 1122 | WP_016189581.1 | tail fiber | - |
LU633_RS15135 (LU633_15135) | 2862794..2863491 | + | 698 | WP_233481924.1 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2855719..2869920 | 14201 | |
- | flank | IS/Tn | - | - | 2862988..2863491 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 67 a.a. Molecular weight: 7685.87 Da Isoelectric Point: 7.3142
>T229721 WP_232426821.1 NZ_CP089932:c2858937-2858737 [Erwinia tracheiphila]
ISKLKTLMTLLINGSLPLPAEYKDHPLQGNYKGYRDAHIEPDWLLIYKITDNLLRFERTGTHSDLF
ISKLKTLMTLLINGSLPLPAEYKDHPLQGNYKGYRDAHIEPDWLLIYKITDNLLRFERTGTHSDLF
Download Length: 201 bp
>T229721 NZ_CP124511:3154774-3154881 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 87 a.a. Molecular weight: 9259.69 Da Isoelectric Point: 5.8213
>AT229721 WP_016189579.1 NZ_CP089932:c2859282-2859022 [Erwinia tracheiphila]
MAANALVRARIDETLKKEAADVLAGMGLTVSDLVRITLTKVAREKALPFDLRIPNEVTANTITASEKGVDVHQAKNADDL
FDKLGI
MAANALVRARIDETLKKEAADVLAGMGLTVSDLVRITLTKVAREKALPFDLRIPNEVTANTITASEKGVDVHQAKNADDL
FDKLGI
Download Length: 261 bp
>AT229721 NZ_CP124511:c3154725-3154660 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|