Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2199648..2200516 | Replicon | chromosome |
Accession | NZ_CP089773 | ||
Organism | Mycobacterium tuberculosis strain 01-R1430 |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | LVJ68_RS10290 | Protein ID | WP_010886136.1 |
Coordinates | 2199648..2200025 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LVJ68_RS10295 | Protein ID | WP_003913306.1 |
Coordinates | 2200067..2200516 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LVJ68_RS10240 (LVJ68_10250) | 2195437..2195889 | - | 453 | WP_003899095.1 | lipoprotein | - |
LVJ68_RS10245 (LVJ68_10255) | 2195953..2196354 | + | 402 | WP_003409869.1 | hypothetical protein | - |
LVJ68_RS10250 (LVJ68_10260) | 2196347..2196529 | - | 183 | WP_003409870.1 | hypothetical protein | - |
LVJ68_RS10255 (LVJ68_10265) | 2196643..2196993 | - | 351 | WP_003899096.1 | hypothetical protein | - |
LVJ68_RS10260 (LVJ68_10270) | 2197004..2197906 | - | 903 | WP_003899097.1 | hypothetical protein | - |
LVJ68_RS10265 (LVJ68_10275) | 2197927..2198118 | - | 192 | WP_003409876.1 | hypothetical protein | - |
LVJ68_RS10270 (LVJ68_10280) | 2198119..2198415 | - | 297 | WP_003409877.1 | hypothetical protein | - |
LVJ68_RS10275 (LVJ68_10285) | 2198655..2198870 | + | 216 | WP_003409878.1 | antitoxin | - |
LVJ68_RS10280 (LVJ68_10290) | 2198867..2199178 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
LVJ68_RS10285 (LVJ68_10295) | 2199152..2199673 | - | 522 | WP_003904745.1 | hypothetical protein | - |
LVJ68_RS10290 (LVJ68_10300) | 2199648..2200025 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
LVJ68_RS10295 (LVJ68_10305) | 2200067..2200516 | + | 450 | WP_003913306.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
LVJ68_RS10300 (LVJ68_10310) | 2200513..2201058 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
LVJ68_RS10305 (LVJ68_10315) | 2200947..2201561 | - | 615 | WP_003901296.1 | hypothetical protein | - |
LVJ68_RS10310 (LVJ68_10320) | 2201610..2201906 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LVJ68_RS10315 (LVJ68_10325) | 2201903..2202154 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
LVJ68_RS10320 (LVJ68_10330) | 2202141..2202635 | + | 495 | WP_003899099.1 | hypothetical protein | - |
LVJ68_RS10325 (LVJ68_10335) | 2202795..2203202 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
LVJ68_RS10330 (LVJ68_10340) | 2203206..2203478 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
LVJ68_RS10335 (LVJ68_10345) | 2203511..2204731 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T228751 WP_010886136.1 NZ_CP089773:2199648-2200025 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
>T228751 NZ_CP124341:2772923-2773030 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 150 a.a. Molecular weight: 16776.16 Da Isoelectric Point: 8.0771
>AT228751 WP_003913306.1 NZ_CP089773:2200067-2200516 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVS
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVS
Download Length: 450 bp
>AT228751 NZ_CP124341:c2772866-2772811 [Escherichia coli]
CAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTC
CAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|