Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1258708..1258929 Replicon chromosome
Accession NC_010658
Organism Shigella boydii CDC 3083-94

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag SBBS512_RS08810 Protein ID WP_000170954.1
Coordinates 1258708..1258815 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1258863..1258929 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SBBS512_RS08785 1254552..1255634 + 1083 WP_000804740.1 peptide chain release factor 1 -
SBBS512_RS08790 1255634..1256467 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
SBBS512_RS08795 1256464..1256856 + 393 WP_000200378.1 invasion regulator SirB2 -
SBBS512_RS08800 1256860..1257669 + 810 WP_001257044.1 invasion regulator SirB1 -
SBBS512_RS08805 1257705..1258559 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
SBBS512_RS08810 1258708..1258815 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1258863..1258929 + 67 NuclAT_39 - Antitoxin
- 1258863..1258929 + 67 NuclAT_39 - Antitoxin
- 1258863..1258929 + 67 NuclAT_39 - Antitoxin
- 1258863..1258929 + 67 NuclAT_39 - Antitoxin
- 1258863..1258929 + 67 NuclAT_41 - Antitoxin
- 1258863..1258929 + 67 NuclAT_41 - Antitoxin
- 1258863..1258929 + 67 NuclAT_41 - Antitoxin
- 1258863..1258929 + 67 NuclAT_41 - Antitoxin
- 1258863..1258929 + 67 NuclAT_43 - Antitoxin
- 1258863..1258929 + 67 NuclAT_43 - Antitoxin
- 1258863..1258929 + 67 NuclAT_43 - Antitoxin
- 1258863..1258929 + 67 NuclAT_43 - Antitoxin
SBBS512_RS08815 1259243..1259350 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1259403..1259464 + 62 NuclAT_27 - -
- 1259403..1259464 + 62 NuclAT_27 - -
- 1259403..1259464 + 62 NuclAT_27 - -
- 1259403..1259464 + 62 NuclAT_27 - -
- 1259403..1259464 + 62 NuclAT_29 - -
- 1259403..1259464 + 62 NuclAT_29 - -
- 1259403..1259464 + 62 NuclAT_29 - -
- 1259403..1259464 + 62 NuclAT_29 - -
- 1259403..1259464 + 62 NuclAT_31 - -
- 1259403..1259464 + 62 NuclAT_31 - -
- 1259403..1259464 + 62 NuclAT_31 - -
- 1259403..1259464 + 62 NuclAT_31 - -
- 1259403..1259464 + 62 NuclAT_33 - -
- 1259403..1259464 + 62 NuclAT_33 - -
- 1259403..1259464 + 62 NuclAT_33 - -
- 1259403..1259464 + 62 NuclAT_33 - -
- 1259403..1259464 + 62 NuclAT_35 - -
- 1259403..1259464 + 62 NuclAT_35 - -
- 1259403..1259464 + 62 NuclAT_35 - -
- 1259403..1259464 + 62 NuclAT_35 - -
- 1259403..1259464 + 62 NuclAT_37 - -
- 1259403..1259464 + 62 NuclAT_37 - -
- 1259403..1259464 + 62 NuclAT_37 - -
- 1259403..1259464 + 62 NuclAT_37 - -
- 1259403..1259465 + 63 NuclAT_38 - -
- 1259403..1259465 + 63 NuclAT_38 - -
- 1259403..1259465 + 63 NuclAT_38 - -
- 1259403..1259465 + 63 NuclAT_38 - -
- 1259403..1259465 + 63 NuclAT_40 - -
- 1259403..1259465 + 63 NuclAT_40 - -
- 1259403..1259465 + 63 NuclAT_40 - -
- 1259403..1259465 + 63 NuclAT_40 - -
- 1259403..1259465 + 63 NuclAT_42 - -
- 1259403..1259465 + 63 NuclAT_42 - -
- 1259403..1259465 + 63 NuclAT_42 - -
- 1259403..1259465 + 63 NuclAT_42 - -
- 1259403..1259466 + 64 NuclAT_15 - -
- 1259403..1259466 + 64 NuclAT_15 - -
- 1259403..1259466 + 64 NuclAT_15 - -
- 1259403..1259466 + 64 NuclAT_15 - -
- 1259403..1259466 + 64 NuclAT_17 - -
- 1259403..1259466 + 64 NuclAT_17 - -
- 1259403..1259466 + 64 NuclAT_17 - -
- 1259403..1259466 + 64 NuclAT_17 - -
- 1259403..1259466 + 64 NuclAT_19 - -
- 1259403..1259466 + 64 NuclAT_19 - -
- 1259403..1259466 + 64 NuclAT_19 - -
- 1259403..1259466 + 64 NuclAT_19 - -
- 1259403..1259466 + 64 NuclAT_21 - -
- 1259403..1259466 + 64 NuclAT_21 - -
- 1259403..1259466 + 64 NuclAT_21 - -
- 1259403..1259466 + 64 NuclAT_21 - -
- 1259403..1259466 + 64 NuclAT_23 - -
- 1259403..1259466 + 64 NuclAT_23 - -
- 1259403..1259466 + 64 NuclAT_23 - -
- 1259403..1259466 + 64 NuclAT_23 - -
- 1259403..1259466 + 64 NuclAT_25 - -
- 1259403..1259466 + 64 NuclAT_25 - -
- 1259403..1259466 + 64 NuclAT_25 - -
- 1259403..1259466 + 64 NuclAT_25 - -
SBBS512_RS08820 1259779..1259886 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1259934..1259999 + 66 NuclAT_26 - -
- 1259934..1259999 + 66 NuclAT_26 - -
- 1259934..1259999 + 66 NuclAT_26 - -
- 1259934..1259999 + 66 NuclAT_26 - -
- 1259934..1259999 + 66 NuclAT_28 - -
- 1259934..1259999 + 66 NuclAT_28 - -
- 1259934..1259999 + 66 NuclAT_28 - -
- 1259934..1259999 + 66 NuclAT_28 - -
- 1259934..1259999 + 66 NuclAT_30 - -
- 1259934..1259999 + 66 NuclAT_30 - -
- 1259934..1259999 + 66 NuclAT_30 - -
- 1259934..1259999 + 66 NuclAT_30 - -
- 1259934..1259999 + 66 NuclAT_32 - -
- 1259934..1259999 + 66 NuclAT_32 - -
- 1259934..1259999 + 66 NuclAT_32 - -
- 1259934..1259999 + 66 NuclAT_32 - -
- 1259934..1259999 + 66 NuclAT_34 - -
- 1259934..1259999 + 66 NuclAT_34 - -
- 1259934..1259999 + 66 NuclAT_34 - -
- 1259934..1259999 + 66 NuclAT_34 - -
- 1259934..1259999 + 66 NuclAT_36 - -
- 1259934..1259999 + 66 NuclAT_36 - -
- 1259934..1259999 + 66 NuclAT_36 - -
- 1259934..1259999 + 66 NuclAT_36 - -
- 1259934..1260001 + 68 NuclAT_14 - -
- 1259934..1260001 + 68 NuclAT_14 - -
- 1259934..1260001 + 68 NuclAT_14 - -
- 1259934..1260001 + 68 NuclAT_14 - -
- 1259934..1260001 + 68 NuclAT_16 - -
- 1259934..1260001 + 68 NuclAT_16 - -
- 1259934..1260001 + 68 NuclAT_16 - -
- 1259934..1260001 + 68 NuclAT_16 - -
- 1259934..1260001 + 68 NuclAT_18 - -
- 1259934..1260001 + 68 NuclAT_18 - -
- 1259934..1260001 + 68 NuclAT_18 - -
- 1259934..1260001 + 68 NuclAT_18 - -
- 1259934..1260001 + 68 NuclAT_20 - -
- 1259934..1260001 + 68 NuclAT_20 - -
- 1259934..1260001 + 68 NuclAT_20 - -
- 1259934..1260001 + 68 NuclAT_20 - -
- 1259934..1260001 + 68 NuclAT_22 - -
- 1259934..1260001 + 68 NuclAT_22 - -
- 1259934..1260001 + 68 NuclAT_22 - -
- 1259934..1260001 + 68 NuclAT_22 - -
- 1259934..1260001 + 68 NuclAT_24 - -
- 1259934..1260001 + 68 NuclAT_24 - -
- 1259934..1260001 + 68 NuclAT_24 - -
- 1259934..1260001 + 68 NuclAT_24 - -
SBBS512_RS08825 1260291..1261391 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
SBBS512_RS08830 1261661..1261891 + 231 WP_001146442.1 putative cation transport regulator ChaB -
SBBS512_RS08835 1262049..1262744 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
SBBS512_RS08840 1262788..1263141 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T22847 WP_000170954.1 NC_010658:c1258815-1258708 [Shigella boydii CDC 3083-94]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T22847 NC_010658:c1258815-1258708 [Shigella boydii CDC 3083-94]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT22847 NC_010658:1258863-1258929 [Shigella boydii CDC 3083-94]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References