Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1258708..1258929 | Replicon | chromosome |
Accession | NC_010658 | ||
Organism | Shigella boydii CDC 3083-94 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | SBBS512_RS08810 | Protein ID | WP_000170954.1 |
Coordinates | 1258708..1258815 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1258863..1258929 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SBBS512_RS08785 | 1254552..1255634 | + | 1083 | WP_000804740.1 | peptide chain release factor 1 | - |
SBBS512_RS08790 | 1255634..1256467 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
SBBS512_RS08795 | 1256464..1256856 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
SBBS512_RS08800 | 1256860..1257669 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
SBBS512_RS08805 | 1257705..1258559 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
SBBS512_RS08810 | 1258708..1258815 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1258863..1258929 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_43 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_43 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_43 | - | Antitoxin |
- | 1258863..1258929 | + | 67 | NuclAT_43 | - | Antitoxin |
SBBS512_RS08815 | 1259243..1259350 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1259403..1259464 | + | 62 | NuclAT_27 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_27 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_27 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_27 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_29 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_29 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_29 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_29 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_31 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_31 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_31 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_31 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_33 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_33 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_33 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_33 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_35 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_35 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_35 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_35 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_37 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_37 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_37 | - | - |
- | 1259403..1259464 | + | 62 | NuclAT_37 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_38 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_38 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_38 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_38 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_40 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_40 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_40 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_40 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_42 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_42 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_42 | - | - |
- | 1259403..1259465 | + | 63 | NuclAT_42 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_15 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_15 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_15 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_15 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_17 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_17 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_17 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_17 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_19 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_19 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_19 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_19 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_21 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_21 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_21 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_21 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_23 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_23 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_23 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_23 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_25 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_25 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_25 | - | - |
- | 1259403..1259466 | + | 64 | NuclAT_25 | - | - |
SBBS512_RS08820 | 1259779..1259886 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1259934..1259999 | + | 66 | NuclAT_26 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_26 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_26 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_26 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_28 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_28 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_28 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_28 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_30 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_30 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_30 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_30 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_32 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_32 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_32 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_32 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_34 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_34 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_34 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_34 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_36 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_36 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_36 | - | - |
- | 1259934..1259999 | + | 66 | NuclAT_36 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_14 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_14 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_14 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_14 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_16 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_16 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_16 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_16 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_18 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_18 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_18 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_18 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_20 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_20 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_20 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_20 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_22 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_22 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_22 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_22 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_24 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_24 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_24 | - | - |
- | 1259934..1260001 | + | 68 | NuclAT_24 | - | - |
SBBS512_RS08825 | 1260291..1261391 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
SBBS512_RS08830 | 1261661..1261891 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
SBBS512_RS08835 | 1262049..1262744 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
SBBS512_RS08840 | 1262788..1263141 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T22847 WP_000170954.1 NC_010658:c1258815-1258708 [Shigella boydii CDC 3083-94]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T22847 NC_010658:c1258815-1258708 [Shigella boydii CDC 3083-94]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT22847 NC_010658:1258863-1258929 [Shigella boydii CDC 3083-94]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|