Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2097497..2097718 Replicon chromosome
Accession NZ_CP089445
Organism Escherichia coli strain 5-1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag LT922_RS10325 Protein ID WP_001531632.1
Coordinates 2097497..2097604 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2097652..2097718 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LT922_RS10300 (2093341) 2093341..2094423 + 1083 WP_000804726.1 peptide chain release factor 1 -
LT922_RS10305 (2094423) 2094423..2095256 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
LT922_RS10310 (2095253) 2095253..2095645 + 393 WP_000200375.1 invasion regulator SirB2 -
LT922_RS10315 (2095649) 2095649..2096458 + 810 WP_001257044.1 invasion regulator SirB1 -
LT922_RS10320 (2096494) 2096494..2097348 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LT922_RS10325 (2097497) 2097497..2097604 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2097654) 2097654..2097717 + 64 NuclAT_12 - -
- (2097654) 2097654..2097717 + 64 NuclAT_12 - -
- (2097654) 2097654..2097717 + 64 NuclAT_12 - -
- (2097654) 2097654..2097717 + 64 NuclAT_12 - -
- (2097654) 2097654..2097717 + 64 NuclAT_13 - -
- (2097654) 2097654..2097717 + 64 NuclAT_13 - -
- (2097654) 2097654..2097717 + 64 NuclAT_13 - -
- (2097654) 2097654..2097717 + 64 NuclAT_13 - -
- (2097654) 2097654..2097717 + 64 NuclAT_14 - -
- (2097654) 2097654..2097717 + 64 NuclAT_14 - -
- (2097654) 2097654..2097717 + 64 NuclAT_14 - -
- (2097654) 2097654..2097717 + 64 NuclAT_14 - -
- (2097654) 2097654..2097717 + 64 NuclAT_15 - -
- (2097654) 2097654..2097717 + 64 NuclAT_15 - -
- (2097654) 2097654..2097717 + 64 NuclAT_15 - -
- (2097654) 2097654..2097717 + 64 NuclAT_15 - -
- (2097654) 2097654..2097717 + 64 NuclAT_16 - -
- (2097654) 2097654..2097717 + 64 NuclAT_16 - -
- (2097654) 2097654..2097717 + 64 NuclAT_16 - -
- (2097654) 2097654..2097717 + 64 NuclAT_16 - -
- (2097654) 2097654..2097717 + 64 NuclAT_17 - -
- (2097654) 2097654..2097717 + 64 NuclAT_17 - -
- (2097654) 2097654..2097717 + 64 NuclAT_17 - -
- (2097654) 2097654..2097717 + 64 NuclAT_17 - -
- (2097652) 2097652..2097718 + 67 NuclAT_10 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_10 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_10 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_10 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_5 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_5 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_5 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_5 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_6 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_6 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_6 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_6 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_7 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_7 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_7 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_7 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_8 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_8 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_8 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_8 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_9 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_9 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_9 - Antitoxin
- (2097652) 2097652..2097718 + 67 NuclAT_9 - Antitoxin
- (2097654) 2097654..2097719 + 66 NuclAT_18 - -
- (2097654) 2097654..2097719 + 66 NuclAT_18 - -
- (2097654) 2097654..2097719 + 66 NuclAT_18 - -
- (2097654) 2097654..2097719 + 66 NuclAT_18 - -
- (2097654) 2097654..2097719 + 66 NuclAT_19 - -
- (2097654) 2097654..2097719 + 66 NuclAT_19 - -
- (2097654) 2097654..2097719 + 66 NuclAT_19 - -
- (2097654) 2097654..2097719 + 66 NuclAT_19 - -
- (2097654) 2097654..2097719 + 66 NuclAT_20 - -
- (2097654) 2097654..2097719 + 66 NuclAT_20 - -
- (2097654) 2097654..2097719 + 66 NuclAT_20 - -
- (2097654) 2097654..2097719 + 66 NuclAT_20 - -
- (2097654) 2097654..2097719 + 66 NuclAT_21 - -
- (2097654) 2097654..2097719 + 66 NuclAT_21 - -
- (2097654) 2097654..2097719 + 66 NuclAT_21 - -
- (2097654) 2097654..2097719 + 66 NuclAT_21 - -
- (2097654) 2097654..2097719 + 66 NuclAT_22 - -
- (2097654) 2097654..2097719 + 66 NuclAT_22 - -
- (2097654) 2097654..2097719 + 66 NuclAT_22 - -
- (2097654) 2097654..2097719 + 66 NuclAT_22 - -
- (2097654) 2097654..2097719 + 66 NuclAT_23 - -
- (2097654) 2097654..2097719 + 66 NuclAT_23 - -
- (2097654) 2097654..2097719 + 66 NuclAT_23 - -
- (2097654) 2097654..2097719 + 66 NuclAT_23 - -
LT922_RS10330 (2098009) 2098009..2099109 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
LT922_RS10335 (2099379) 2099379..2099618 + 240 WP_000120702.1 putative cation transport regulator ChaB -
LT922_RS10340 (2099767) 2099767..2100462 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
LT922_RS10345 (2100506) 2100506..2100859 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
LT922_RS10350 (2101044) 2101044..2102438 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T228282 WP_001531632.1 NZ_CP089445:c2097604-2097497 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T228282 NZ_CP123618:c1680364-1680185 [Pasteurella multocida]
ATGATGAAACAAAGTGAGTTTTTAAGATGGCTGAAAGCTCAAGGGGTAGAAACTAAAGAAGGCTCAAACCACATTAAGCT
CTACCTAAACGGCAAACAATCAGCTCTCCCAAGACATCCAAGTAAAGAGATAGCCAAGGGAACTGAAATAGCAGTTAAAA
AGCAATTAGGTCTAAAATAA

Antitoxin


Download         Length: 67 bp

>AT228282 NZ_CP089445:2097652-2097718 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References