Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2542849..2543033 | Replicon | chromosome |
Accession | NZ_CP089159 | ||
Organism | Staphylococcus aureus strain UNC_SaCF18 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | LTK20_RS12830 | Protein ID | WP_000482650.1 |
Coordinates | 2542849..2542956 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2542973..2543033 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LTK20_RS12805 | 2538211..2538684 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
LTK20_RS12810 | 2538807..2540018 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
LTK20_RS12815 | 2540200..2540859 | - | 660 | WP_000831298.1 | membrane protein | - |
LTK20_RS12820 | 2540919..2542061 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
LTK20_RS12825 | 2542329..2542715 | + | 387 | WP_000779358.1 | flippase GtxA | - |
LTK20_RS12830 | 2542849..2542956 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2542973..2543033 | - | 61 | - | - | Antitoxin |
LTK20_RS12835 | 2543584..2545347 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein | - |
LTK20_RS12840 | 2545372..2547105 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
LTK20_RS12845 | 2547336..2547503 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T227750 WP_000482650.1 NZ_CP089159:2542849-2542956 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T227750 NZ_CP123029:2079874-2079977 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT227750 NZ_CP089159:c2543033-2542973 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|