Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 565228..565408 | Replicon | chromosome |
| Accession | NZ_CP089157 | ||
| Organism | Staphylococcus aureus strain UNC_SaCF30 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | LTK17_RS02660 | Protein ID | WP_001801861.1 |
| Coordinates | 565228..565323 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 565351..565408 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LTK17_RS02630 (LTK17_02630) | 560372..560998 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| LTK17_RS02635 (LTK17_02635) | 561039..561383 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| LTK17_RS02640 (LTK17_02640) | 561481..562053 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| LTK17_RS02645 (LTK17_02645) | 562202..563569 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| LTK17_RS02650 (LTK17_02650) | 563569..564138 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LTK17_RS02655 (LTK17_02655) | 564331..564777 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| LTK17_RS02660 (LTK17_02660) | 565228..565323 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 565351..565408 | - | 58 | - | - | Antitoxin |
| LTK17_RS02665 (LTK17_02665) | 565446..565547 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| LTK17_RS02670 (LTK17_02670) | 565722..566165 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| LTK17_RS02675 (LTK17_02675) | 566165..566608 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| LTK17_RS02680 (LTK17_02680) | 566608..567050 | - | 443 | Protein_532 | DUF1433 domain-containing protein | - |
| LTK17_RS02685 (LTK17_02685) | 567575..569995 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T227729 WP_001801861.1 NZ_CP089157:565228-565323 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T227729 NZ_CP123024:2719962-2720069 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT227729 NZ_CP089157:c565408-565351 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|