Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 101260..101686 | Replicon | plasmid pEH13_2 |
| Accession | NZ_CP089099 | ||
| Organism | Klebsiella pneumoniae strain EH13 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LSG42_RS28310 | Protein ID | WP_001372321.1 |
| Coordinates | 101260..101385 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 101462..101686 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LSG42_RS28275 (96283) | 96283..96510 | - | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
| LSG42_RS28280 (96647) | 96647..97318 | - | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| LSG42_RS28285 (97512) | 97512..97895 | - | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LSG42_RS28290 (98230) | 98230..98820 | + | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| LSG42_RS28295 (99117) | 99117..99938 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| LSG42_RS28300 (100049) | 100049..100345 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| LSG42_RS28305 (100645) | 100645..100941 | + | 297 | Protein_118 | hypothetical protein | - |
| LSG42_RS28310 (101260) | 101260..101385 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LSG42_RS28315 (101327) | 101327..101476 | - | 150 | Protein_120 | plasmid maintenance protein Mok | - |
| - (101462) | 101462..101686 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (101462) | 101462..101686 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (101462) | 101462..101686 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (101462) | 101462..101686 | - | 225 | NuclAT_0 | - | Antitoxin |
| LSG42_RS28320 (101698) | 101698..102417 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| LSG42_RS28325 (102414) | 102414..102848 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| LSG42_RS28330 (102917) | 102917..104940 | - | 2024 | Protein_123 | ParB/RepB/Spo0J family partition protein | - |
| LSG42_RS28335 (105001) | 105001..105234 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| LSG42_RS28340 (105292) | 105292..105819 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| LSG42_RS28345 (106121) | 106121..106576 | + | 456 | Protein_126 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / erm(42) / sul2 / tet(M) / mph(A) / erm(B) / blaCTX-M-14 / qacE / cmlA1 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..152520 | 152520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T227651 WP_001372321.1 NZ_CP089099:c101385-101260 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T227651 NZ_CP123009:1327855-1327962 [Escherichia coli O155]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 225 bp
>AT227651 NZ_CP089099:c101686-101462 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|