Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3541342..3541567 | Replicon | chromosome |
| Accession | NZ_CP089036 | ||
| Organism | Escherichia coli O157:H7 strain 7386WT | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | CO544_RS18405 | Protein ID | WP_000813263.1 |
| Coordinates | 3541342..3541497 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3541509..3541567 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CO544_RS18370 | 3536796..3537509 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| CO544_RS18375 | 3537647..3537843 | - | 197 | Protein_3608 | TrmB family transcriptional regulator | - |
| CO544_RS18380 | 3538130..3538948 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| CO544_RS18385 | 3539100..3539471 | - | 372 | WP_000090264.1 | antiterminator Q family protein | - |
| CO544_RS18390 | 3539461..3539832 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CO544_RS18395 | 3539845..3540894 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| CO544_RS18400 | 3540896..3541174 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| CO544_RS18405 | 3541342..3541497 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3541509..3541567 | + | 59 | - | - | Antitoxin |
| CO544_RS18415 | 3542102..3542875 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| CO544_RS18420 | 3543227..3543640 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| CO544_RS18425 | 3543656..3544426 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| CO544_RS18430 | 3544448..3545194 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
| CO544_RS18435 | 3545201..3546298 | - | 1098 | WP_001475117.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T227540 WP_000813263.1 NZ_CP089036:c3541497-3541342 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T227540 NZ_CP122938:2843510-2843617 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTTGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTTGCGTAACCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT227540 NZ_CP089036:3541509-3541567 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|