Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4969892..4970304 | Replicon | chromosome |
Accession | NZ_CP089032 | ||
Organism | Escherichia coli O157:H7 strain 6535WT |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | LSI69_RS25360 | Protein ID | WP_000132630.1 |
Coordinates | 4969963..4970304 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4969892..4969968 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSI69_RS25350 (4966519) | 4966519..4967988 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
LSI69_RS25355 (4967988) | 4967988..4969742 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4969892) | 4969892..4969968 | - | 77 | NuclAT_16 | - | Antitoxin |
LSI69_RS25360 (4969963) | 4969963..4970304 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
LSI69_RS25365 (4970351) | 4970351..4971514 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
LSI69_RS25370 (4971562) | 4971562..4972443 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
LSI69_RS25375 (4972586) | 4972586..4972738 | - | 153 | WP_001418365.1 | hypothetical protein | - |
LSI69_RS25380 (4972881) | 4972881..4974293 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 4962091..4983318 | 21227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T227484 WP_000132630.1 NZ_CP089032:4969963-4970304 [Escherichia coli O157:H7]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T227484 NZ_CP122923:207560-207667 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 77 bp
>AT227484 NZ_CP089032:c4969968-4969892 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|