Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2642568..2642793 | Replicon | chromosome |
Accession | NZ_CP089031 | ||
Organism | Escherichia coli strain 7386Nal |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | CO543_RS13460 | Protein ID | WP_000813258.1 |
Coordinates | 2642568..2642723 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2642735..2642793 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CO543_RS13410 | 2637571..2638002 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
CO543_RS13425 | 2638453..2639166 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
CO543_RS13430 | 2639302..2639499 | - | 198 | WP_000917763.1 | hypothetical protein | - |
CO543_RS13435 | 2639724..2640278 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
CO543_RS13440 | 2640341..2640646 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
CO543_RS13445 | 2640659..2641708 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
CO543_RS13450 | 2641710..2641982 | - | 273 | WP_000191872.1 | hypothetical protein | - |
CO543_RS13455 | 2642104..2642448 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
CO543_RS13460 | 2642568..2642723 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 2642735..2642793 | + | 59 | - | - | Antitoxin |
CO543_RS13465 | 2643014..2643571 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
CO543_RS13470 | 2643573..2643791 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
CO543_RS13475 | 2643919..2644230 | - | 312 | WP_001289673.1 | hypothetical protein | - |
CO543_RS13480 | 2644223..2644450 | - | 228 | WP_000699809.1 | hypothetical protein | - |
CO543_RS13485 | 2644447..2644728 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
CO543_RS13490 | 2644761..2645477 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
CO543_RS13495 | 2645511..2645972 | - | 462 | WP_000139447.1 | replication protein P | - |
CO543_RS13500 | 2645965..2647008 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
CO543_RS13505 | 2647077..2647502 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
CO543_RS13510 | 2647486..2647728 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2612114..2699614 | 87500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T227438 WP_000813258.1 NZ_CP089031:c2642723-2642568 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T227438 NZ_CP122874:90881-91030 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT227438 NZ_CP089031:2642735-2642793 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|