Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 139454..139707 Replicon plasmid p50700-140.6
Accession NZ_CP088995
Organism Klebsiella pneumoniae strain 50700

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag LRZ81_RS28525 Protein ID WP_001312851.1
Coordinates 139558..139707 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 139454..139513 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LRZ81_RS28480 (134487) 134487..134792 + 306 WP_004144424.1 type IV conjugative transfer system protein TraL -
LRZ81_RS28485 (134812) 134812..135177 + 366 Protein_174 type IV conjugative transfer system protein TraE -
LRZ81_RS28490 (135232) 135232..135936 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
LRZ81_RS28495 (135961) 135961..136161 + 201 WP_072354025.1 hypothetical protein -
LRZ81_RS28500 (136181) 136181..136927 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
LRZ81_RS28505 (136982) 136982..137542 + 561 WP_000139328.1 fertility inhibition protein FinO -
LRZ81_RS28510 (137674) 137674..137874 + 201 WP_015059022.1 hypothetical protein -
LRZ81_RS28515 (138260) 138260..138859 + 600 WP_032083981.1 PIN domain-containing protein -
LRZ81_RS28520 (138921) 138921..139253 + 333 WP_152916585.1 hypothetical protein -
- (139454) 139454..139513 - 60 NuclAT_1 - Antitoxin
- (139454) 139454..139513 - 60 NuclAT_1 - Antitoxin
- (139454) 139454..139513 - 60 NuclAT_1 - Antitoxin
- (139454) 139454..139513 - 60 NuclAT_1 - Antitoxin
LRZ81_RS28525 (139558) 139558..139707 + 150 WP_001312851.1 Hok/Gef family protein Toxin
LRZ81_RS28530 (139991) 139991..140239 + 249 WP_000083837.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-65 / blaSHV-12 / blaKPC-2 - 1..140550 140550
- flank IS/Tn - - 135232..135936 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T227283 WP_001312851.1 NZ_CP088995:139558-139707 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T227283 NZ_CP122823:3050159-3050266 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT227283 NZ_CP088995:c139513-139454 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References