Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 139454..139707 | Replicon | plasmid p50700-140.6 |
| Accession | NZ_CP088995 | ||
| Organism | Klebsiella pneumoniae strain 50700 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LRZ81_RS28525 | Protein ID | WP_001312851.1 |
| Coordinates | 139558..139707 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 139454..139513 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRZ81_RS28480 (134487) | 134487..134792 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| LRZ81_RS28485 (134812) | 134812..135177 | + | 366 | Protein_174 | type IV conjugative transfer system protein TraE | - |
| LRZ81_RS28490 (135232) | 135232..135936 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LRZ81_RS28495 (135961) | 135961..136161 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| LRZ81_RS28500 (136181) | 136181..136927 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| LRZ81_RS28505 (136982) | 136982..137542 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| LRZ81_RS28510 (137674) | 137674..137874 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| LRZ81_RS28515 (138260) | 138260..138859 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| LRZ81_RS28520 (138921) | 138921..139253 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (139454) | 139454..139513 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (139454) | 139454..139513 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (139454) | 139454..139513 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (139454) | 139454..139513 | - | 60 | NuclAT_1 | - | Antitoxin |
| LRZ81_RS28525 (139558) | 139558..139707 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| LRZ81_RS28530 (139991) | 139991..140239 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 / blaSHV-12 / blaKPC-2 | - | 1..140550 | 140550 | |
| - | flank | IS/Tn | - | - | 135232..135936 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T227283 WP_001312851.1 NZ_CP088995:139558-139707 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T227283 NZ_CP122823:3050159-3050266 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT227283 NZ_CP088995:c139513-139454 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|