Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 29094..29363 | Replicon | plasmid p50700-140.6 |
Accession | NZ_CP088995 | ||
Organism | Klebsiella pneumoniae strain 50700 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | LRZ81_RS27805 | Protein ID | WP_001372321.1 |
Coordinates | 29238..29363 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 29094..29159 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LRZ81_RS27770 | 24096..24557 | - | 462 | Protein_31 | hypothetical protein | - |
LRZ81_RS27775 | 24859..25386 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
LRZ81_RS27780 | 25444..25677 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
LRZ81_RS27785 | 25738..27706 | + | 1969 | Protein_34 | ParB/RepB/Spo0J family partition protein | - |
LRZ81_RS27790 | 27775..28209 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
LRZ81_RS27795 | 28206..28925 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 28937..29161 | + | 225 | NuclAT_0 | - | - |
- | 28937..29161 | + | 225 | NuclAT_0 | - | - |
- | 28937..29161 | + | 225 | NuclAT_0 | - | - |
- | 28937..29161 | + | 225 | NuclAT_0 | - | - |
- | 29094..29159 | - | 66 | - | - | Antitoxin |
LRZ81_RS27800 | 29147..29296 | + | 150 | Protein_37 | plasmid maintenance protein Mok | - |
LRZ81_RS27805 | 29238..29363 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
LRZ81_RS27810 | 29682..29978 | - | 297 | Protein_39 | hypothetical protein | - |
LRZ81_RS27815 | 30278..30574 | + | 297 | WP_001272251.1 | hypothetical protein | - |
LRZ81_RS27820 | 30685..31506 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
LRZ81_RS27825 | 31803..32450 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
LRZ81_RS27830 | 32727..33110 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
LRZ81_RS27835 | 33301..33987 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
LRZ81_RS27840 | 34081..34308 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-65 / blaSHV-12 / blaKPC-2 | - | 1..140550 | 140550 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T227279 WP_001372321.1 NZ_CP088995:29238-29363 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T227279 NZ_CP122823:2277697-2277800 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 66 bp
>AT227279 NZ_CP088995:c29159-29094 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|