Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 27262..27515 Replicon plasmid unnamed2
Accession NZ_CP088271
Organism Klebsiella pneumoniae strain CRKP-27

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag LQ775_RS27420 Protein ID WP_001312851.1
Coordinates 27366..27515 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 27262..27321 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ775_RS27365 (22268) 22268..22516 + 249 Protein_33 IS1380 family transposase -
LQ775_RS27370 (22519) 22519..22605 + 87 Protein_34 hypothetical protein -
LQ775_RS27375 (22636) 22636..22977 + 342 WP_004202492.1 RamA family antibiotic efflux transcriptional regulator -
LQ775_RS27380 (22995) 22995..23243 - 249 WP_065809026.1 DUF1158 domain-containing protein -
LQ775_RS27385 (23535) 23535..23744 - 210 Protein_37 IS6 family transposase -
LQ775_RS27390 (23769) 23769..23969 + 201 WP_072354025.1 hypothetical protein -
LQ775_RS27395 (23989) 23989..24735 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
LQ775_RS27400 (24790) 24790..25350 + 561 WP_000139328.1 fertility inhibition protein FinO -
LQ775_RS27405 (25482) 25482..25682 + 201 WP_015059022.1 hypothetical protein -
LQ775_RS27410 (26068) 26068..26667 + 600 WP_032083981.1 PIN domain-containing protein -
LQ775_RS27415 (26729) 26729..27061 + 333 WP_152916585.1 hypothetical protein -
- (27262) 27262..27321 - 60 NuclAT_0 - Antitoxin
- (27262) 27262..27321 - 60 NuclAT_0 - Antitoxin
- (27262) 27262..27321 - 60 NuclAT_0 - Antitoxin
- (27262) 27262..27321 - 60 NuclAT_0 - Antitoxin
LQ775_RS27420 (27366) 27366..27515 + 150 WP_001312851.1 Hok/Gef family protein Toxin
LQ775_RS27425 (27799) 27799..28047 + 249 WP_000083837.1 replication regulatory protein RepA -
LQ775_RS27430 (28292) 28292..28366 + 75 WP_001375168.1 RepA leader peptide Tap -
LQ775_RS27435 (28359) 28359..29216 + 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
LQ775_RS27440 (30155) 30155..30808 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
LQ775_RS27445 (30901) 30901..31158 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
LQ775_RS27450 (31091) 31091..31492 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aadA5 / qacE / sul1 / blaKPC-2 - 1..76708 76708


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T227056 WP_001312851.1 NZ_CP088271:27366-27515 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T227056 NZ_CP122685:2894914-2895021 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTTGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT227056 NZ_CP088271:c27321-27262 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References