Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 27262..27515 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP088271 | ||
| Organism | Klebsiella pneumoniae strain CRKP-27 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LQ775_RS27420 | Protein ID | WP_001312851.1 |
| Coordinates | 27366..27515 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 27262..27321 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ775_RS27365 (22268) | 22268..22516 | + | 249 | Protein_33 | IS1380 family transposase | - |
| LQ775_RS27370 (22519) | 22519..22605 | + | 87 | Protein_34 | hypothetical protein | - |
| LQ775_RS27375 (22636) | 22636..22977 | + | 342 | WP_004202492.1 | RamA family antibiotic efflux transcriptional regulator | - |
| LQ775_RS27380 (22995) | 22995..23243 | - | 249 | WP_065809026.1 | DUF1158 domain-containing protein | - |
| LQ775_RS27385 (23535) | 23535..23744 | - | 210 | Protein_37 | IS6 family transposase | - |
| LQ775_RS27390 (23769) | 23769..23969 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| LQ775_RS27395 (23989) | 23989..24735 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| LQ775_RS27400 (24790) | 24790..25350 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| LQ775_RS27405 (25482) | 25482..25682 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| LQ775_RS27410 (26068) | 26068..26667 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| LQ775_RS27415 (26729) | 26729..27061 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (27262) | 27262..27321 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (27262) | 27262..27321 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (27262) | 27262..27321 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (27262) | 27262..27321 | - | 60 | NuclAT_0 | - | Antitoxin |
| LQ775_RS27420 (27366) | 27366..27515 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| LQ775_RS27425 (27799) | 27799..28047 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| LQ775_RS27430 (28292) | 28292..28366 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| LQ775_RS27435 (28359) | 28359..29216 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| LQ775_RS27440 (30155) | 30155..30808 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| LQ775_RS27445 (30901) | 30901..31158 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| LQ775_RS27450 (31091) | 31091..31492 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aadA5 / qacE / sul1 / blaKPC-2 | - | 1..76708 | 76708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T227056 WP_001312851.1 NZ_CP088271:27366-27515 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T227056 NZ_CP122685:2894914-2895021 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTTGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTTGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT227056 NZ_CP088271:c27321-27262 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|