Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1860825..1861132 | Replicon | chromosome |
| Accession | NZ_CP088158 | ||
| Organism | Staphylococcus aureus strain 697 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | LRP64_RS08830 | Protein ID | WP_011447039.1 |
| Coordinates | 1860956..1861132 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1860825..1860964 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRP64_RS08790 (1856164) | 1856164..1856424 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| LRP64_RS08795 (1856477) | 1856477..1856827 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| LRP64_RS08800 (1857512) | 1857512..1857961 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| LRP64_RS08805 (1858056) | 1858056..1858391 | - | 336 | Protein_1732 | SH3 domain-containing protein | - |
| LRP64_RS08810 (1859041) | 1859041..1859532 | - | 492 | WP_000919350.1 | staphylokinase | - |
| LRP64_RS08815 (1859723) | 1859723..1860478 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| LRP64_RS08820 (1860490) | 1860490..1860744 | - | 255 | WP_000611512.1 | phage holin | - |
| LRP64_RS08825 (1860796) | 1860796..1860903 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (1860825) | 1860825..1860964 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1860825) | 1860825..1860964 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1860825) | 1860825..1860964 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1860825) | 1860825..1860964 | + | 140 | NuclAT_0 | - | Antitoxin |
| LRP64_RS08830 (1860956) | 1860956..1861132 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| LRP64_RS08835 (1861282) | 1861282..1861578 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LRP64_RS08840 (1861636) | 1861636..1861923 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| LRP64_RS08845 (1861970) | 1861970..1862122 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| LRP64_RS08850 (1862112) | 1862112..1865897 | - | 3786 | WP_044557000.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hysA / scn / chp / sak | 1843812..1904140 | 60328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T226882 WP_011447039.1 NZ_CP088158:c1861132-1860956 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T226882 NZ_CP122648:2907631-2907738 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCGTGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCGTGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 140 bp
>AT226882 NZ_CP088158:1860825-1860964 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
