Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 180238..180844 | Replicon | chromosome |
| Accession | NZ_CP087768 | ||
| Organism | Moraxella bovis strain SAM109245 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | LP116_RS00925 | Protein ID | WP_228157738.1 |
| Coordinates | 180509..180844 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LP116_RS00920 | Protein ID | WP_078274722.1 |
| Coordinates | 180238..180519 (-) | Length | 94 a.a. |
Genomic Context
Location: 175936..176694 (759 bp)
Type: Others
Protein ID: WP_078274726.1
Type: Others
Protein ID: WP_078274726.1
Location: 176804..178129 (1326 bp)
Type: Others
Protein ID: WP_112741690.1
Type: Others
Protein ID: WP_112741690.1
Location: 178274..178996 (723 bp)
Type: Others
Protein ID: WP_029103568.1
Type: Others
Protein ID: WP_029103568.1
Location: 183335..183580 (246 bp)
Type: Others
Protein ID: WP_078274709.1
Type: Others
Protein ID: WP_078274709.1
Location: 183867..184142 (276 bp)
Type: Others
Protein ID: WP_078274708.1
Type: Others
Protein ID: WP_078274708.1
Location: 179036..179248 (213 bp)
Type: Others
Protein ID: WP_078274724.1
Type: Others
Protein ID: WP_078274724.1
Location: 179364..180188 (825 bp)
Type: Others
Protein ID: WP_078274723.1
Type: Others
Protein ID: WP_078274723.1
Location: 180238..180519 (282 bp)
Type: Antitoxin
Protein ID: WP_078274722.1
Type: Antitoxin
Protein ID: WP_078274722.1
Location: 180509..180844 (336 bp)
Type: Toxin
Protein ID: WP_228157738.1
Type: Toxin
Protein ID: WP_228157738.1
Location: 180908..182068 (1161 bp)
Type: Others
Protein ID: WP_078274721.1
Type: Others
Protein ID: WP_078274721.1
Location: 182154..182447 (294 bp)
Type: Others
Protein ID: WP_078274720.1
Type: Others
Protein ID: WP_078274720.1
Location: 182444..183076 (633 bp)
Type: Others
Protein ID: WP_264684100.1
Type: Others
Protein ID: WP_264684100.1
Location: 184137..184292 (156 bp)
Type: Others
Protein ID: WP_158079680.1
Type: Others
Protein ID: WP_158079680.1
Location: 184344..184478 (135 bp)
Type: Others
Protein ID: WP_264676041.1
Type: Others
Protein ID: WP_264676041.1
Location: 184466..184807 (342 bp)
Type: Others
Protein ID: WP_228157741.1
Type: Others
Protein ID: WP_228157741.1
Location: 184981..185121 (141 bp)
Type: Others
Protein ID: WP_029103571.1
Type: Others
Protein ID: WP_029103571.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LP116_RS00895 (LP116_00895) | 175936..176694 | + | 759 | WP_078274726.1 | YciK family oxidoreductase | - |
| LP116_RS00900 (LP116_00900) | 176804..178129 | + | 1326 | WP_112741690.1 | hemolysin family protein | - |
| LP116_RS00905 (LP116_00905) | 178274..178996 | + | 723 | WP_029103568.1 | nitroreductase family protein | - |
| LP116_RS00910 (LP116_00910) | 179036..179248 | - | 213 | WP_078274724.1 | hypothetical protein | - |
| LP116_RS00915 (LP116_00915) | 179364..180188 | - | 825 | WP_078274723.1 | site-specific integrase | - |
| LP116_RS00920 (LP116_00920) | 180238..180519 | - | 282 | WP_078274722.1 | NadS family protein | Antitoxin |
| LP116_RS00925 (LP116_00925) | 180509..180844 | - | 336 | WP_228157738.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LP116_RS00930 (LP116_00930) | 180908..182068 | - | 1161 | WP_078274721.1 | zonular occludens toxin domain-containing protein | - |
| LP116_RS00935 (LP116_00935) | 182154..182447 | - | 294 | WP_078274720.1 | DUF2523 family protein | - |
| LP116_RS00940 (LP116_00940) | 182444..183076 | - | 633 | WP_264684100.1 | virulence factor TspB C-terminal domain-related protein | - |
| LP116_RS00945 (LP116_00945) | 183335..183580 | + | 246 | WP_078274709.1 | hypothetical protein | - |
| LP116_RS00950 (LP116_00950) | 183867..184142 | + | 276 | WP_078274708.1 | hypothetical protein | - |
| LP116_RS00955 (LP116_00955) | 184137..184292 | - | 156 | WP_158079680.1 | hypothetical protein | - |
| LP116_RS00960 | 184344..184478 | - | 135 | WP_264676041.1 | hypothetical protein | - |
| LP116_RS00965 (LP116_00960) | 184466..184807 | - | 342 | WP_228157741.1 | hemerythrin domain-containing protein | - |
| LP116_RS00970 (LP116_00965) | 184981..185121 | - | 141 | WP_029103571.1 | type B 50S ribosomal protein L36 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12636.69 Da Isoelectric Point: 10.0972
>T226107 WP_228157738.1 NZ_CP087768:c180844-180509 [Moraxella bovis]
MLHFAETSLFTKQIIDLMDDDEYRLLQTNLMKNPHQGDIVRGTGGVRKTRWSIDGKGKSGGSRIIYFFVDGAGIFFMLLA
YPKSKQTTLSADEKKEMLKLTTAIKEIYRAK
MLHFAETSLFTKQIIDLMDDDEYRLLQTNLMKNPHQGDIVRGTGGVRKTRWSIDGKGKSGGSRIIYFFVDGAGIFFMLLA
YPKSKQTTLSADEKKEMLKLTTAIKEIYRAK
Download Length: 336 bp
>T226107 NZ_CP122301:c2443863-2443708 [Salmonella enterica]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 94 a.a. Molecular weight: 10425.98 Da Isoelectric Point: 10.0023
>AT226107 WP_078274722.1 NZ_CP087768:c180519-180238 [Moraxella bovis]
VQNEFYDDLKASLTEALAIAKGEISPSRTFTYERPNIKDIRAKTGLSQTQFAQKLHISPKTLKNWEQGIRTPTGPAITLI
RLLDKNPDLISMA
VQNEFYDDLKASLTEALAIAKGEISPSRTFTYERPNIKDIRAKTGLSQTQFAQKLHISPKTLKNWEQGIRTPTGPAITLI
RLLDKNPDLISMA
Download Length: 282 bp
>AT226107 NZ_CP122301:2443875-2443933 [Salmonella enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA