Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37144..37413 | Replicon | plasmid pDD01845-3 |
| Accession | NZ_CP087666 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain DD01845 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LMH56_RS29055 | Protein ID | WP_001372321.1 |
| Coordinates | 37288..37413 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 37144..37209 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LMH56_RS29025 | 32854..33381 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| LMH56_RS29030 | 33439..33672 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| LMH56_RS29035 | 33733..35756 | + | 2024 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
| LMH56_RS29040 | 35825..36259 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| LMH56_RS29045 | 36256..36975 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 36987..37211 | + | 225 | NuclAT_0 | - | - |
| - | 36987..37211 | + | 225 | NuclAT_0 | - | - |
| - | 36987..37211 | + | 225 | NuclAT_0 | - | - |
| - | 36987..37211 | + | 225 | NuclAT_0 | - | - |
| - | 37144..37209 | - | 66 | - | - | Antitoxin |
| LMH56_RS29050 | 37197..37346 | + | 150 | Protein_48 | plasmid maintenance protein Mok | - |
| LMH56_RS29055 | 37288..37413 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LMH56_RS29060 | 37732..38028 | - | 297 | Protein_50 | hypothetical protein | - |
| LMH56_RS29065 | 38328..38624 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| LMH56_RS29070 | 38735..39556 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| LMH56_RS29075 | 39853..40500 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| LMH56_RS29080 | 40777..41160 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LMH56_RS29085 | 41351..42037 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| LMH56_RS29090 | 42131..42358 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..112224 | 112224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T225906 WP_001372321.1 NZ_CP087666:37288-37413 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T225906 NZ_CP121529:2113828-2114016 [Staphylococcus epidermidis]
ATGAGCTTACATTTCCAAATTTTGCTGTGGCTTTCTATCTTATTTATCATCGCAGGAACGATATTATTGGTAACAATGCT
TAAAACTAAAAAAGAAGAACGAAAAGAATCTTATCTAGGCTTTACTGTAATTTTCTTAATCTTTGGTTTTGCCATCTTAA
TTTATACTTTTATATTCGGAATTTTATAA
ATGAGCTTACATTTCCAAATTTTGCTGTGGCTTTCTATCTTATTTATCATCGCAGGAACGATATTATTGGTAACAATGCT
TAAAACTAAAAAAGAAGAACGAAAAGAATCTTATCTAGGCTTTACTGTAATTTTCTTAATCTTTGGTTTTGCCATCTTAA
TTTATACTTTTATATTCGGAATTTTATAA
Antitoxin
Download Length: 66 bp
>AT225906 NZ_CP087666:c37209-37144 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|