Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2094169..2094389 | Replicon | chromosome |
Accession | NZ_CP087578 | ||
Organism | Escherichia coli strain OSUCMP42NDM |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | KUA31_RS10305 | Protein ID | WP_000170954.1 |
Coordinates | 2094169..2094276 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2094326..2094389 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KUA31_RS10280 (2090013) | 2090013..2091095 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
KUA31_RS10285 (2091095) | 2091095..2091928 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
KUA31_RS10290 (2091925) | 2091925..2092317 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
KUA31_RS10295 (2092321) | 2092321..2093130 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
KUA31_RS10300 (2093166) | 2093166..2094020 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
KUA31_RS10305 (2094169) | 2094169..2094276 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_29 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_29 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_29 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_29 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_32 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_32 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_32 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_32 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_35 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_35 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_35 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_35 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_38 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_38 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_38 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_38 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_41 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_41 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_41 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_41 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_44 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_44 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_44 | - | Antitoxin |
- (2094326) | 2094326..2094389 | + | 64 | NuclAT_44 | - | Antitoxin |
KUA31_RS10310 (2094704) | 2094704..2094811 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_28 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_28 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_28 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_28 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_31 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_31 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_31 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_31 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_34 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_34 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_34 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_34 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_37 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_37 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_37 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_37 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_40 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_40 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_40 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_40 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_43 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_43 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_43 | - | - |
- (2094864) | 2094864..2094925 | + | 62 | NuclAT_43 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_16 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_16 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_16 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_16 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_18 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_18 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_18 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_18 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_20 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_20 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_20 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_20 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_22 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_22 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_22 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_22 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_24 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_24 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_24 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_24 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_26 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_26 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_26 | - | - |
- (2094864) | 2094864..2094927 | + | 64 | NuclAT_26 | - | - |
KUA31_RS10315 (2095240) | 2095240..2095347 | - | 108 | WP_075861447.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_27 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_27 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_27 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_27 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_30 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_30 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_30 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_30 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_33 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_33 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_33 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_33 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_36 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_36 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_36 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_36 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_39 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_39 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_39 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_39 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_42 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_42 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_42 | - | - |
- (2095395) | 2095395..2095460 | + | 66 | NuclAT_42 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_15 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_15 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_15 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_15 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_17 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_17 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_17 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_17 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_19 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_19 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_19 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_19 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_21 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_21 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_21 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_21 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_23 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_23 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_23 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_23 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_25 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_25 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_25 | - | - |
- (2095395) | 2095395..2095462 | + | 68 | NuclAT_25 | - | - |
KUA31_RS10320 (2095752) | 2095752..2096852 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
KUA31_RS10325 (2097122) | 2097122..2097352 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
KUA31_RS10330 (2097510) | 2097510..2098205 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
KUA31_RS10335 (2098249) | 2098249..2098602 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T225554 WP_000170954.1 NZ_CP087578:c2094276-2094169 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T225554 NZ_CP121189:943957-944355 [Salmonella enterica subsp. enterica serovar Indiana]
ATGCTGAAATTCATGCTTGATACCAATACCTGTATTTTCACCATCAAAAATAAGCCCGAACACATCAGAGAACGCTTCAA
CCTCAATACATCCCGAATGTGTATCAGCTCCATCACCTTAATGGAGCTGATTTACGGTGCTGAAAAAAGCCTGGCGCCGG
AGCGTAATCTTGCCGTCGTGGAGGGATTTATCTCCCGCCTTGAGGTTCTGGATTACGATACACAGGCAGCGATACATACC
GGTCAAATCCGTGCCGAACTGGCCCGCAAGGGAACACCTGTCGGGCCTTATGACCAGATGATTGCTGGCCATGCCCGTAG
CCGCGGACTGGTCGTCGTCACAAACAATCTCCGCGAGTTTGAACGCATTCCGGGTATCCGAATCGAAGACTGGTGCTAA
ATGCTGAAATTCATGCTTGATACCAATACCTGTATTTTCACCATCAAAAATAAGCCCGAACACATCAGAGAACGCTTCAA
CCTCAATACATCCCGAATGTGTATCAGCTCCATCACCTTAATGGAGCTGATTTACGGTGCTGAAAAAAGCCTGGCGCCGG
AGCGTAATCTTGCCGTCGTGGAGGGATTTATCTCCCGCCTTGAGGTTCTGGATTACGATACACAGGCAGCGATACATACC
GGTCAAATCCGTGCCGAACTGGCCCGCAAGGGAACACCTGTCGGGCCTTATGACCAGATGATTGCTGGCCATGCCCGTAG
CCGCGGACTGGTCGTCGTCACAAACAATCTCCGCGAGTTTGAACGCATTCCGGGTATCCGAATCGAAGACTGGTGCTAA
Antitoxin
Download Length: 64 bp
>AT225554 NZ_CP087578:2094326-2094389 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|