Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2094169..2094389 Replicon chromosome
Accession NZ_CP087578
Organism Escherichia coli strain OSUCMP42NDM

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag KUA31_RS10305 Protein ID WP_000170954.1
Coordinates 2094169..2094276 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2094326..2094389 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KUA31_RS10280 (2090013) 2090013..2091095 + 1083 WP_000804726.1 peptide chain release factor 1 -
KUA31_RS10285 (2091095) 2091095..2091928 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
KUA31_RS10290 (2091925) 2091925..2092317 + 393 WP_000200378.1 invasion regulator SirB2 -
KUA31_RS10295 (2092321) 2092321..2093130 + 810 WP_001257044.1 invasion regulator SirB1 -
KUA31_RS10300 (2093166) 2093166..2094020 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KUA31_RS10305 (2094169) 2094169..2094276 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2094326) 2094326..2094389 + 64 NuclAT_29 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_29 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_29 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_29 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_32 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_32 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_32 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_32 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_35 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_35 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_35 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_35 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_38 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_38 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_38 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_38 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_41 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_41 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_41 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_41 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_44 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_44 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_44 - Antitoxin
- (2094326) 2094326..2094389 + 64 NuclAT_44 - Antitoxin
KUA31_RS10310 (2094704) 2094704..2094811 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2094864) 2094864..2094925 + 62 NuclAT_28 - -
- (2094864) 2094864..2094925 + 62 NuclAT_28 - -
- (2094864) 2094864..2094925 + 62 NuclAT_28 - -
- (2094864) 2094864..2094925 + 62 NuclAT_28 - -
- (2094864) 2094864..2094925 + 62 NuclAT_31 - -
- (2094864) 2094864..2094925 + 62 NuclAT_31 - -
- (2094864) 2094864..2094925 + 62 NuclAT_31 - -
- (2094864) 2094864..2094925 + 62 NuclAT_31 - -
- (2094864) 2094864..2094925 + 62 NuclAT_34 - -
- (2094864) 2094864..2094925 + 62 NuclAT_34 - -
- (2094864) 2094864..2094925 + 62 NuclAT_34 - -
- (2094864) 2094864..2094925 + 62 NuclAT_34 - -
- (2094864) 2094864..2094925 + 62 NuclAT_37 - -
- (2094864) 2094864..2094925 + 62 NuclAT_37 - -
- (2094864) 2094864..2094925 + 62 NuclAT_37 - -
- (2094864) 2094864..2094925 + 62 NuclAT_37 - -
- (2094864) 2094864..2094925 + 62 NuclAT_40 - -
- (2094864) 2094864..2094925 + 62 NuclAT_40 - -
- (2094864) 2094864..2094925 + 62 NuclAT_40 - -
- (2094864) 2094864..2094925 + 62 NuclAT_40 - -
- (2094864) 2094864..2094925 + 62 NuclAT_43 - -
- (2094864) 2094864..2094925 + 62 NuclAT_43 - -
- (2094864) 2094864..2094925 + 62 NuclAT_43 - -
- (2094864) 2094864..2094925 + 62 NuclAT_43 - -
- (2094864) 2094864..2094927 + 64 NuclAT_16 - -
- (2094864) 2094864..2094927 + 64 NuclAT_16 - -
- (2094864) 2094864..2094927 + 64 NuclAT_16 - -
- (2094864) 2094864..2094927 + 64 NuclAT_16 - -
- (2094864) 2094864..2094927 + 64 NuclAT_18 - -
- (2094864) 2094864..2094927 + 64 NuclAT_18 - -
- (2094864) 2094864..2094927 + 64 NuclAT_18 - -
- (2094864) 2094864..2094927 + 64 NuclAT_18 - -
- (2094864) 2094864..2094927 + 64 NuclAT_20 - -
- (2094864) 2094864..2094927 + 64 NuclAT_20 - -
- (2094864) 2094864..2094927 + 64 NuclAT_20 - -
- (2094864) 2094864..2094927 + 64 NuclAT_20 - -
- (2094864) 2094864..2094927 + 64 NuclAT_22 - -
- (2094864) 2094864..2094927 + 64 NuclAT_22 - -
- (2094864) 2094864..2094927 + 64 NuclAT_22 - -
- (2094864) 2094864..2094927 + 64 NuclAT_22 - -
- (2094864) 2094864..2094927 + 64 NuclAT_24 - -
- (2094864) 2094864..2094927 + 64 NuclAT_24 - -
- (2094864) 2094864..2094927 + 64 NuclAT_24 - -
- (2094864) 2094864..2094927 + 64 NuclAT_24 - -
- (2094864) 2094864..2094927 + 64 NuclAT_26 - -
- (2094864) 2094864..2094927 + 64 NuclAT_26 - -
- (2094864) 2094864..2094927 + 64 NuclAT_26 - -
- (2094864) 2094864..2094927 + 64 NuclAT_26 - -
KUA31_RS10315 (2095240) 2095240..2095347 - 108 WP_075861447.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2095395) 2095395..2095460 + 66 NuclAT_27 - -
- (2095395) 2095395..2095460 + 66 NuclAT_27 - -
- (2095395) 2095395..2095460 + 66 NuclAT_27 - -
- (2095395) 2095395..2095460 + 66 NuclAT_27 - -
- (2095395) 2095395..2095460 + 66 NuclAT_30 - -
- (2095395) 2095395..2095460 + 66 NuclAT_30 - -
- (2095395) 2095395..2095460 + 66 NuclAT_30 - -
- (2095395) 2095395..2095460 + 66 NuclAT_30 - -
- (2095395) 2095395..2095460 + 66 NuclAT_33 - -
- (2095395) 2095395..2095460 + 66 NuclAT_33 - -
- (2095395) 2095395..2095460 + 66 NuclAT_33 - -
- (2095395) 2095395..2095460 + 66 NuclAT_33 - -
- (2095395) 2095395..2095460 + 66 NuclAT_36 - -
- (2095395) 2095395..2095460 + 66 NuclAT_36 - -
- (2095395) 2095395..2095460 + 66 NuclAT_36 - -
- (2095395) 2095395..2095460 + 66 NuclAT_36 - -
- (2095395) 2095395..2095460 + 66 NuclAT_39 - -
- (2095395) 2095395..2095460 + 66 NuclAT_39 - -
- (2095395) 2095395..2095460 + 66 NuclAT_39 - -
- (2095395) 2095395..2095460 + 66 NuclAT_39 - -
- (2095395) 2095395..2095460 + 66 NuclAT_42 - -
- (2095395) 2095395..2095460 + 66 NuclAT_42 - -
- (2095395) 2095395..2095460 + 66 NuclAT_42 - -
- (2095395) 2095395..2095460 + 66 NuclAT_42 - -
- (2095395) 2095395..2095462 + 68 NuclAT_15 - -
- (2095395) 2095395..2095462 + 68 NuclAT_15 - -
- (2095395) 2095395..2095462 + 68 NuclAT_15 - -
- (2095395) 2095395..2095462 + 68 NuclAT_15 - -
- (2095395) 2095395..2095462 + 68 NuclAT_17 - -
- (2095395) 2095395..2095462 + 68 NuclAT_17 - -
- (2095395) 2095395..2095462 + 68 NuclAT_17 - -
- (2095395) 2095395..2095462 + 68 NuclAT_17 - -
- (2095395) 2095395..2095462 + 68 NuclAT_19 - -
- (2095395) 2095395..2095462 + 68 NuclAT_19 - -
- (2095395) 2095395..2095462 + 68 NuclAT_19 - -
- (2095395) 2095395..2095462 + 68 NuclAT_19 - -
- (2095395) 2095395..2095462 + 68 NuclAT_21 - -
- (2095395) 2095395..2095462 + 68 NuclAT_21 - -
- (2095395) 2095395..2095462 + 68 NuclAT_21 - -
- (2095395) 2095395..2095462 + 68 NuclAT_21 - -
- (2095395) 2095395..2095462 + 68 NuclAT_23 - -
- (2095395) 2095395..2095462 + 68 NuclAT_23 - -
- (2095395) 2095395..2095462 + 68 NuclAT_23 - -
- (2095395) 2095395..2095462 + 68 NuclAT_23 - -
- (2095395) 2095395..2095462 + 68 NuclAT_25 - -
- (2095395) 2095395..2095462 + 68 NuclAT_25 - -
- (2095395) 2095395..2095462 + 68 NuclAT_25 - -
- (2095395) 2095395..2095462 + 68 NuclAT_25 - -
KUA31_RS10320 (2095752) 2095752..2096852 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
KUA31_RS10325 (2097122) 2097122..2097352 + 231 WP_001146442.1 putative cation transport regulator ChaB -
KUA31_RS10330 (2097510) 2097510..2098205 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
KUA31_RS10335 (2098249) 2098249..2098602 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T225554 WP_000170954.1 NZ_CP087578:c2094276-2094169 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T225554 NZ_CP121189:943957-944355 [Salmonella enterica subsp. enterica serovar Indiana]
ATGCTGAAATTCATGCTTGATACCAATACCTGTATTTTCACCATCAAAAATAAGCCCGAACACATCAGAGAACGCTTCAA
CCTCAATACATCCCGAATGTGTATCAGCTCCATCACCTTAATGGAGCTGATTTACGGTGCTGAAAAAAGCCTGGCGCCGG
AGCGTAATCTTGCCGTCGTGGAGGGATTTATCTCCCGCCTTGAGGTTCTGGATTACGATACACAGGCAGCGATACATACC
GGTCAAATCCGTGCCGAACTGGCCCGCAAGGGAACACCTGTCGGGCCTTATGACCAGATGATTGCTGGCCATGCCCGTAG
CCGCGGACTGGTCGTCGTCACAAACAATCTCCGCGAGTTTGAACGCATTCCGGGTATCCGAATCGAAGACTGGTGCTAA

Antitoxin


Download         Length: 64 bp

>AT225554 NZ_CP087578:2094326-2094389 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References